HSD3B1 Recombinant Protein Antigen

Images

 
There are currently no images for HSD3B1 Recombinant Protein Antigen (NBP2-46700PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

HSD3B1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human HSD3B1.

Source: E. coli

Amino Acid Sequence: ESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
HSD3B1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-46700.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for HSD3B1 Recombinant Protein Antigen

  • 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
  • 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I
  • 3-beta-HSD I
  • 3BETAHSD
  • 3-beta-hydroxy-Delta(5)-steroid dehydrogenase
  • 3BH
  • delta-5-3-ketosteroid isomerase
  • EC 1.1.1
  • HSD3B
  • HSDB3
  • HSDB3A
  • hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
  • hydroxy-delta-5-steroid dehydrogenase, 3 beta-and steroid delta-isomerase 1
  • I
  • progesterone reductase
  • SDR11E1
  • short chain dehydrogenase/reductase family 11E, member 1,3-beta-hydroxy-5-ene steroid dehydrogenase
  • steroid Delta-isomerase
  • Trophoblast antigen FDO161G

Background

3beta-hydroxysteroid dehydrogenase/delta(5)-delta(4)isomerase (HSD3B1) is a bifunctional enzyme involved in the oxidative conversion of steroids and plays an important role in the synthesis of all steroid hormones. There are two HSD3B1 proteins--designated type I and type II--that are expressed by different genes and function in different areas of the body. HSD3B1 has also been shown to be a highly specific and sensitive trophoblast-associated marker.

HSD3B1 is required for the production of progesterone by the placenta, so it is predicted that mutations in this gene may cause infertility in women. HSD3B1 antibodies are useful tools for researchers studying hormone regulation and reproductive biology.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85368
Species: Hu, RM
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-01151
Species: Hu
Applications: Flow, IHC,  IHC-P, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP1-33485
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-32353
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP2-88921
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13893
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-38770
Species: Hu, Mu
Applications:  IHC-P, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
NBP1-30475
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
MAB7450
Species: Hu
Applications: IHC
NBP2-49223
Species: Hu
Applications: IHC,  IHC-P
AF1445
Species: Mu, Rt
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, Simple Western, WB
NBP2-13891
Species: Hu
Applications: IHC,  IHC-P
AF7178
Species: Hu
Applications: IHC, Simple Western, WB
NBP2-49284
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
NLS1436
Species: Bv, Ca, Hu
Applications: IHC,  IHC-P

Publications for HSD3B1 Recombinant Protein Antigen (NBP2-46700PEP) (0)

There are no publications for HSD3B1 Recombinant Protein Antigen (NBP2-46700PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD3B1 Recombinant Protein Antigen (NBP2-46700PEP) (0)

There are no reviews for HSD3B1 Recombinant Protein Antigen (NBP2-46700PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for HSD3B1 Recombinant Protein Antigen (NBP2-46700PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional HSD3B1 Products

Research Areas for HSD3B1 Recombinant Protein Antigen (NBP2-46700PEP)

Find related products by research area.

Blogs on HSD3B1

There are no specific blogs for HSD3B1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our HSD3B1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD3B1