HSD3B1 Antibody

Images

 
Western Blot: HSD3B1 Antibody [H00003283-B01P] - Analysis of HSD3B1 expression in transfected 293T cell line by HSD3B1 polyclonal antibody. Lane 1: HSD3B1 transfected lysate(41.03 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HSD3B1 Antibody Summary

Immunogen
HSD3B1 (NP_000853.1, 1 a.a. - 373 a.a.) full-length human protein. MTGWSCLVTGAGGFLGQRIIRLLVKEKELKEIRVLDKAFGPELREEFSKLQNKTKLTVLEGDILDEPFLKRACQDVSVIIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPAPYPHSKKLAEKAVLAANGWNLKNGGTLYTCALRPMYIYGEGSRFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALQDPKKAPSIRGQFYYISDDTPHQSYDNLNYTLSKEFGLRLDSRWSFPLSLMYWIGFLLEIVSFLLRPIYTYRPPFNRHIVTLSNSVFTFSYKKAQRDLAYKPLYSWEEAKQKTVEWVGSLVDRHKETLKSKTQ
Marker
Trophoblast-associated Marker
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
HSD3B1
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HSD3B1 Antibody

  • 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type 1
  • 3 beta-hydroxysteroid dehydrogenase/Delta 5-->4-isomerase type I
  • 3-beta-HSD I
  • 3BETAHSD
  • 3-beta-hydroxy-Delta(5)-steroid dehydrogenase
  • 3BH
  • delta-5-3-ketosteroid isomerase
  • EC 1.1.1
  • HSD3B
  • HSDB3
  • HSDB3A
  • hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 1
  • hydroxy-delta-5-steroid dehydrogenase, 3 beta-and steroid delta-isomerase 1
  • I
  • progesterone reductase
  • SDR11E1
  • short chain dehydrogenase/reductase family 11E, member 1,3-beta-hydroxy-5-ene steroid dehydrogenase
  • steroid Delta-isomerase
  • Trophoblast antigen FDO161G

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NBP1-33485
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-13893
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-30475
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP, PLA
MAB7450
Species: Hu
Applications: IHC
NBP1-68883
Species: Hu, Mu, Mk
Applications: WB, IHC
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-56518
Species: Hu
Applications: WB
MAB7178
Species: Hu
Applications: WB, Simple Western
NBP2-49284
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NLS1436
Species: Hu
Applications: IHC-P

Publications for HSD3B1 Antibody (H00003283-B01P) (0)

There are no publications for HSD3B1 Antibody (H00003283-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD3B1 Antibody (H00003283-B01P) (0)

There are no reviews for HSD3B1 Antibody (H00003283-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSD3B1 Antibody (H00003283-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSD3B1 Products

Bioinformatics Tool for HSD3B1 Antibody (H00003283-B01P)

Discover related pathways, diseases and genes to HSD3B1 Antibody (H00003283-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSD3B1 Antibody (H00003283-B01P)

Discover more about diseases related to HSD3B1 Antibody (H00003283-B01P).
 

Pathways for HSD3B1 Antibody (H00003283-B01P)

View related products by pathway.

PTMs for HSD3B1 Antibody (H00003283-B01P)

Learn more about PTMs related to HSD3B1 Antibody (H00003283-B01P).
 

Research Areas for HSD3B1 Antibody (H00003283-B01P)

Find related products by research area.

Blogs on HSD3B1

There are no specific blogs for HSD3B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSD3B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD3B1
Uniprot