HSD17B7 Antibody (1G10)

Images

 
Western Blot: HSD17B7 Antibody (1G10) [H00051478-M01] - HSD17B7 monoclonal antibody (M01), clone 1G10. Analysis of HSD17B7 expression in rat testis.
Immunocytochemistry/ Immunofluorescence: HSD17B7 Antibody (1G10) [H00051478-M01] - Analysis of monoclonal antibody to HSD17B7 on HeLa cell . Antibody concentration 10 ug/ml.
Sandwich ELISA: HSD17B7 Antibody (1G10) [H00051478-M01] - Detection limit for recombinant GST tagged HSD17B7 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications WB, ELISA, ICC/IF, S-ELISA
Clone
1G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HSD17B7 Antibody (1G10) Summary

Immunogen
HSD17B7 (NP_057455.1, 255 a.a. ~ 341 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQKMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSCL
Specificity
HSD17B7 - hydroxysteroid (17-beta) dehydrogenase 7 (1G10)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HSD17B7
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HSD17B7 Antibody (1G10)

  • 17 beta-hydroxysteroid dehydrogenase type VII
  • 17-beta-hydroxysteroid dehydrogenase 7
  • 3-keto-steroid reductase
  • EC 1.1.1.270
  • EC 1.1.1.62
  • Estradiol 17-beta-dehydrogenase 7
  • hydroxysteroid (17-beta) dehydrogenase 7,17beta hydroxysteroid dehydrogenase
  • MGC12523
  • MGC75018,17-beta-HSD 7
  • PRAP
  • SDR37C1
  • short chain dehydrogenase/reductase family 37C, member 1

Background

The 17-beta-hydroxysteroid dehydrogenase enzyme (EC 1.1.1.62) oxidizes or reduces estrogens and androgens in mammals and regulates the biologic potency of these steroids.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89388
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1596
Species: Hu, Mu, Pm, Rb, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NBP1-84901
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB300-560
Species: Av, Bv, Ma, Hu, Mu, Pm, Rt
Applications: IF, IHC, IHC-Fr, IHC-P, WB
AF682
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, Neut, WB
NBP1-92011
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85368
Species: Hu, RM
Applications: ICC/IF, IHC, IHC-P, WB
DKK300
Species: Hu
Applications: ELISA
NBP1-33485
Species: Hu, Mu, Po
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67627
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-561
Species: Bv, Eq, Ha, Hu, Mu, Po, Rb, Rt, Sh
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NB200-305
Species: Hu, Pm, Mu, Rb
Applications: ChIP, DB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
H00005087-M01
Species: Hu, Pm, Mu
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, S-ELISA, WB
NBP2-01223
Species: Hu
Applications: Flow, IHC, IHC-P, WB
AF5415
Species: Hu
Applications: ICC, IHC, Simple Western, WB
DPSG10
Species: Hu
Applications: ELISA
7678-DH
Species: Hu
Applications: EnzAct
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
H00051478-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA

Publications for HSD17B7 Antibody (H00051478-M01) (0)

There are no publications for HSD17B7 Antibody (H00051478-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD17B7 Antibody (H00051478-M01) (0)

There are no reviews for HSD17B7 Antibody (H00051478-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSD17B7 Antibody (H00051478-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSD17B7 Products

Bioinformatics Tool for HSD17B7 Antibody (H00051478-M01)

Discover related pathways, diseases and genes to HSD17B7 Antibody (H00051478-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSD17B7 Antibody (H00051478-M01)

Discover more about diseases related to HSD17B7 Antibody (H00051478-M01).
 

Pathways for HSD17B7 Antibody (H00051478-M01)

View related products by pathway.

PTMs for HSD17B7 Antibody (H00051478-M01)

Learn more about PTMs related to HSD17B7 Antibody (H00051478-M01).
 

Research Areas for HSD17B7 Antibody (H00051478-M01)

Find related products by research area.

Blogs on HSD17B7

There are no specific blogs for HSD17B7, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSD17B7 Antibody (1G10) and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD17B7
Entrez
Uniprot