HSD17B7 Antibody (1G10) - Azide and BSA Free

Western Blot: HSD17B7 Antibody (1G10) [H00051478-M01] - HSD17B7 monoclonal antibody (M01), clone 1G10. Analysis of HSD17B7 expression in rat testis.

Immunocytochemistry/Immunofluorescence: HSD17B7 Antibody (1G10) [H00051478-M01] - Analysis of monoclonal antibody to HSD17B7 on HeLa cell . Antibody concentration 10 ug/ml.

Sandwich ELISA: HSD17B7 Antibody (1G10) [H00051478-M01] - Detection limit for recombinant GST tagged HSD17B7 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu, Rt
• Applications: WB, ELISA, ICC/IF
• Clone: 1G10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HSD17B7 Antibody (1G10) - Azide and BSA Free Summary

• Immunogen: HSD17B7 (NP_057455.1, 255 a.a. ~ 341 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NAFTLTPYNGTEALVWLFHQKPESLNPLIKYLSATTGFGRNYIMTQKMDLDEDTAEKFYQKLLELEKHIRVTIQKTDNQARLSGSCL
• Specificity: HSD17B7 - hydroxysteroid (17-beta) dehydrogenase 7 (1G10)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HSD17B7
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HSD17B7 Antibody (1G10) - Azide and BSA Free

• 17 beta-hydroxysteroid dehydrogenase type VII
• 17-beta-hydroxysteroid dehydrogenase 7
• 3-keto-steroid reductase
• EC 1.1.1.270
• EC 1.1.1.62
• Estradiol 17-beta-dehydrogenase 7
• hydroxysteroid (17-beta) dehydrogenase 7,17beta hydroxysteroid dehydrogenase
• MGC12523
• MGC75018,17-beta-HSD 7
• PRAP
• SDR37C1
• short chain dehydrogenase/reductase family 37C, member 1

Background

The 17-beta-hydroxysteroid dehydrogenase enzyme (EC 1.1.1.62) oxidizes or reduces estrogens and androgens in mammals and regulates the biologic potency of these steroids.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HSD17B7
• Entrez:
  • 51478(Human)
• Uniprot:
  • NP_057455(Human)