HSD17B4 Antibody

Images

 
Western Blot: HSD17B4 Antibody [NBP1-85296] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: HSD17B4 Antibody [NBP1-85296] - Staining of human cell line A-431 shows localization to peroxisomes. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human lung.
Western Blot: HSD17B4 Antibody [NBP1-85296] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Independent Antibodies: Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human liver, lung, lymph node and testis using Anti-HSD17B4 antibody NBP1-85296 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human liver.
Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human testis.
Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human lymph node.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

HSD17B4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: ESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSK
Specificity
Specificity of human HSD17B4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSD17B4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Reviewed Applications
Read 1 Review rated 4
using
NBP1-85296 in the following applications:

Publications
Read Publications using
NBP1-85296 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HSD17B4 Antibody

  • 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase
  • 7-alpha
  • D-bifunctional protein
  • EDH17B4
  • hydroxysteroid (17-beta) dehydrogenase 4
  • MPF-2
  • peroxisomal multifunctional enzyme type 2,17-beta-HSD IV
  • peroxisomal multifunctional protein 2,17beta-estradiol dehydrogenase type IV
  • peroxisomal
  • short chain dehydrogenase/reductase family 8C, member 1,3-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-41532
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-62346
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
AF2307
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-88573
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1793
Species: Hu, Mu, Mk
Applications: WB, IB, ICC/IF, IHC, IHC-Fr, IHC-P, PEP-ELISA
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-395
Species: Hu, Pm
Applications: Flow, IHC, IHC-P, IP, Flow-CS
NBP1-31559
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88027
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
AF7895
Species: Hu
Applications: WB, IHC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2288
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC

Publications for HSD17B4 Antibody (NBP1-85296)(3)

Review for HSD17B4 Antibody (NBP1-85296) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: human embryonic kidney 293 cells and Human.

Reviews using NBP1-85296:
Filter by Applications
WB
(1)
All Applications
Filter by Species
human embryonic kidney 293 cells and Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot HSD17B4 NBP1-85296
Enlarge
reviewed by:
Zhihui Zhu
WB human embryonic kidney 293 cells and Human 12/12/2018
View

Summary

ApplicationWestern Blot
Sample Tested20 micro gram,20 ug whole cell lysate
Specieshuman embryonic kidney 293 cells and Human
LotR09826

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSD17B4 Antibody (NBP1-85296) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HSD17B4 Products

Bioinformatics Tool for HSD17B4 Antibody (NBP1-85296)

Discover related pathways, diseases and genes to HSD17B4 Antibody (NBP1-85296). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSD17B4 Antibody (NBP1-85296)

Discover more about diseases related to HSD17B4 Antibody (NBP1-85296).
 

Pathways for HSD17B4 Antibody (NBP1-85296)

View related products by pathway.

PTMs for HSD17B4 Antibody (NBP1-85296)

Learn more about PTMs related to HSD17B4 Antibody (NBP1-85296).

Blogs on HSD17B4

There are no specific blogs for HSD17B4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Zhihui Zhu
12/12/2018
Application: WB
Species: human embryonic kidney 293 cells and Human

Bioinformatics

Gene Symbol HSD17B4