HSD17B4 Antibody - BSA Free

Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human liver, lung, lymph node and testis using Anti-HSD17B4 antibody NBP1-85296 (A) shows similar protein distribution across tissues to independent antibody NBP1-85297 (B).

Immunocytochemistry/Immunofluorescence: HSD17B4 Antibody [NBP1-85296] - Staining of human cell line A-431 shows localization to peroxisomes. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human lung.

Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human liver.

Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human testis.

Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human lymph node.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HSD17B4 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HSD17B4 Antibody - BSA Free (NBP1-85296) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-HSD17B4 Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: ESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSK
• Predicted Species: Mouse (95%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HSD17B4
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HSD17B4 Protein (NBP1-85296PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HSD17B4 Antibody - BSA Free

• 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase
• 7-alpha
• D-bifunctional protein
• EDH17B4
• hydroxysteroid (17-beta) dehydrogenase 4
• MPF-2
• peroxisomal multifunctional enzyme type 2,17-beta-HSD IV
• peroxisomal multifunctional protein 2,17beta-estradiol dehydrogenase type IV
• peroxisomal
• short chain dehydrogenase/reductase family 8C, member 1,3-alpha

Background

The protein encoded by the HSD17B4 gene is a bifunctional enzyme that is involved in the peroxisomal beta-oxidation pathwayfor fatty acids. It also acts as a catalyst for the formation of 3-ketoacyl-CoA intermediates from both straight-chainand 2-methyl-branched-chain fatty acids. Defects in this gene that affect the peroxisomal fatty acid beta-oxidationactivity are a cause of D-bifunctional protein deficiency (DBPD). An apparent pseudogene of this gene is present onchromosome 8. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HSD17B4 Antibody (NBP1-85296)(3)

Publications using NBP1-85296

• Zhu Z, Chen J, Wang G et al. Ceramide regulates interaction of Hsd17b4 with Pex5 and function of peroxisomes Biochim Biophys Acta Mol Cell Biol Lipids 2019-06-05 [PMID: 31176039] (Mouse)
• Cabre R, Naudi A, Dominguez-Gonzalez M et al. Lipid Profile in Human Frontal Cortex is Sustained Throughout Healthy Adult Lifespan to Decay at Advanced Ages J. Gerontol. A Biol. Sci. Med. Sci. 2017-08-31 [PMID: 28958038] (WB, Human)
• Naudi A, Cabre R, Dominguez-Gonzalez M et al. Region-specific vulnerability to lipid peroxidation and evidence of neuronal mechanisms for polyunsaturated fatty acid biosynthesis in the healthy adult human central nervous system. Biochim. Biophys. Acta. 2017-02-07 [PMID: 28185952]

Review for HSD17B4 Antibody (NBP1-85296) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human and human embryonic kidney 293 cells.

reviewed by: Zhihui Zhu WB Human and human embryonic kidney 293 cells 12/12/2018

Summary

• Application: Western Blot
• Sample Tested: 20 micro gram,20 ug whole cell lysate
• Species: Human and human embryonic kidney 293 cells
• Lot: R09826

Bioinformatics

• Gene Symbol: HSD17B4