HSD17B4 Antibody


Western Blot: HSD17B4 Antibody [NBP1-85296] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: HSD17B4 Antibody [NBP1-85296] - Staining of human cell line A-431 shows localization to peroxisomes.
Immunohistochemistry-Paraffin: HSD17B4 Antibody [NBP1-85296] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.
Western Blot: HSD17B4 Antibody [NBP1-85296] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

HSD17B4 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: ESCEENGGLFEVGAGWIGKLRWERTLGAIVRQKNHPMTPEAVKANWKKICDFENASKPQSIQESTGSIIEVLSK
Specificity of human, mouse, rat HSD17B4 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HSD17B4 Protein (NBP1-85296PEP)
Read Publications using
NBP1-85296 in the following applications:

  • WB
    1 publication

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HSD17B4 Antibody

  • 12-alpha-trihydroxy-5-beta-cholest-24-enoyl-CoA hydratase
  • 7-alpha
  • D-bifunctional protein
  • EDH17B4
  • hydroxysteroid (17-beta) dehydrogenase 4
  • MPF-2
  • peroxisomal multifunctional enzyme type 2,17-beta-HSD IV
  • peroxisomal multifunctional protein 2,17beta-estradiol dehydrogenase type IV
  • peroxisomal
  • short chain dehydrogenase/reductase family 8C, member 1,3-alpha


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
Species: Hu
Applications: IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-Fr, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HSD17B4 Antibody (NBP1-85296)(2)

Reviews for HSD17B4 Antibody (NBP1-85296) (0)

There are no reviews for HSD17B4 Antibody (NBP1-85296). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HSD17B4 Antibody (NBP1-85296) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional HSD17B4 Products

Bioinformatics Tool for HSD17B4 Antibody (NBP1-85296)

Discover related pathways, diseases and genes to HSD17B4 Antibody (NBP1-85296). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSD17B4 Antibody (NBP1-85296)

Discover more about diseases related to HSD17B4 Antibody (NBP1-85296).

Pathways for HSD17B4 Antibody (NBP1-85296)

View related products by pathway.

PTMs for HSD17B4 Antibody (NBP1-85296)

Learn more about PTMs related to HSD17B4 Antibody (NBP1-85296).

Blogs on HSD17B4

There are no specific blogs for HSD17B4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HSD17B4 Antibody and receive a gift card or discount.


Gene Symbol HSD17B4