Home » HSD17B3 » HSD17B3 Antibodies » HSD17B3 Antibody

HSD17B3 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: HSD17B3 Antibody [H00003293-B01P] - Analysis of HSD17B3 expression in transfected 293T cell line by HSD17B3 polyclonal antibody. Lane1:HSD17B3 transfected lysate(34.1 KDa). Lane2:Non-transfected lysate.
Western Blot: HSD17B3 Antibody [H00003293-B01P] - Analysis of HSD17B3 expression in transfected 293T cell line by HSD17B3 polyclonal antibody. Lane1:HSD17B3 transfected lysate(34.1 KDa). Lane2:Non-transfected lysate.
Western Blot: HSD17B3 Antibody [H00003293-B01P] - analysis of HSD17B3 expression in transfected 293T cell line by HSD17B3 MaxPab polyclonal antibody. Lane1: HSD17B3 transfected lysate (34.1 KDa). Lane2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HSD17B3 Antibody Summary

Immunogen
HSD17B3 (NP_000188.1, 1 a.a. - 310 a.a.) full-length human protein. MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKLAGLEIGILVNNVGMLPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYVAYLKLNTKVR
Specificity
HSD17B3 - hydroxysteroid (17-beta) dehydrogenase 3,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
HSD17B3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HSD17B3 Antibody

  • EC 1.1.1.64
  • EDH17B317-beta-HSD3
  • hydroxysteroid (17-beta) dehydrogenase 3,17-beta-hydroxysteroid dehydrogenase type 3
  • SDR12C2
  • short chain dehydrogenase/reductase family 12C, member 2
  • Testicular 17-beta-hydroxysteroid dehydrogenase
  • testosterone 17-beta-dehydrogenase 3,17-beta-HSD 3

Background

This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Cytochrome P450
17A1 Antibody (OTI3F1
NBP2-01151
Western Blot: Cytochrome P450 17A1 Antibody (3F11) [NBP2-01151] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Cytochrome P450 17A1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Cytochrome P450 17A1.
Immunohistochemistry-Paraffin: Cytochrome P450 17A1 Antibody (3F11) [NBP2-01151] - Staining of paraffin-embedded Human tonsil using anti-Cytochrome P450 17A1 mouse monoclonal antibody.
Flow Cytometry: Cytochrome P450 17A1 Antibody (3F11) [NBP2-01151] - Analysis of Jurkat cells, using anti-Cytochrome P450 17A1 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Androgen R/NR3C4
[p Ser213, p Ser210] ...
NB100-56603
Western Blot: Androgen R/NR3C4 [p Ser213, p Ser210] Antibody (156C135.2) [NB100-56603] - Analysis using Azide Free version of NB100-56603. LNCaP cells (passage number 38) were serum-starved for 2 days. After serum starvation, cells were (A) left untreated, (B) treated with 100 ng/ml IGF-1 for 4h, or (C) incubated with 20 um LY294002 for 30 mi
(12 Publications)
Species: Hu, Pm
Applications: WB, IHC, IHC-P
CYP11A1 Antibody
NBP1-54758
Western Blot: CYP11A1 Antibody [NBP1-54758] - Sample Type: Hela Antibody Dilution: 1.0 ug/ml CYP11A1 is supported by BioGPS gene expression data to be expressed in HeLa
Immunohistochemistry: CYP11A1 Antibody [NBP1-54758] - Human Placenta lysate tissue at an antibody concentration of 5.0 ug/ml using anti-CYP11A1 antibody
Western Blot: CYP11A1 Antibody [NBP1-54758] - CYP11A1 antibody - middle region validated by WB using Hela cell lysate at 1ug/ml.
Species: Hu
Applications: WB, IHC, IHC-P
Aromatase Antibody
NB100-1596
Western Blot: Aromatase Antibody [NB100-1596] - Detection of aromatase in human fetal temporal lobe lysate using NB 100-1596. ECL exposure, 1-2 minutes.
Immunocytochemistry/Immunofluorescence: Aromatase Antibody [NB100-1596] - Aromatase antibody was tested in SH-SY-5Y cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
(5 Publications)
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
ER alpha/NR3A1
Antibody (EVG F9)
NB100-74413
Western Blot: ER alpha/NR3A1 Antibody (EVG F9) [NB100-74413] - Analysis of various whole cell lysates.
Immunocytochemistry/Immunofluorescence: ER alpha/NR3A1 Antibody (EVG F9) [NB100-74413] - Analysis of Estrogen Receptor alpha using Anti-Estrogen Receptor alpha Monoclonal Antibody (EVG F9) shows staining in U251 Cells. Estrogen Receptor alpha staining (green), F-Actin staining with Phalloidin (red) and nuclei with DAPI (blue) is shown. Cells were grown on chamber slides and fixed with formaldehyde prior to staining. Cells were probed without (control) or with or an antibody recognizing Estrogen Receptor alpha at a dilution of 1:200 over night at 4C, washed with PBS and incubated with a DyLight-488 conjugated.
Immunohistochemistry-Paraffin: ER alpha/NR3A1 Antibody (EVG F9) [NB100-74413] - Cancer biopsies of deparaffinized Human breast carcinoma tissues.
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
SRD5A2 Antibody
NBP1-46510
Western Blot: SRD5A2 Antibody [NBP1-46510] - WB on mouse tissue lysate. Blocking: 1% LFDM for 30 min at RT; primary antibody: dilution 1:4000 incubated at 4C overnight.
Immunohistochemistry-Paraffin: SRD5A2 Antibody [NBP1-46510] - IHC-P on paraffin sections of human placenta. HIER: Tris-EDTA, pH 9 for 20 min. Blocking: 0.2% LFDM in TBST filtered thru 0.2 um.Detection was done using HRP polymer from manufacturers instructions; DAB chromogen.Primary antibody: dilution 1: 1000, incubated 30 min at RT using Autostainer.Sections were counterstained with Harris Hematoxylin.
Immunohistochemistry-Paraffin: SRD5A2 Antibody [NBP1-46510] - IHC-P on paraffin sections of human pancreas. HIER: Tris-EDTA, pH 9 for 20 min. Blocking: 0.2% LFDM in TBST filtered thru 0.2 um.Detection was done using using HRP polymer following manufacturers inctructions. DAB chromogen.Primary antibody: dilution 1: 1000, incubated 30 min at RT using Autostainer.Sections were counterstained with Harris Hematoxylin.
Species: Hu, Mu
Applications: WB, IHC, IHC-P
HSD3B1 Antibody
(FDO66Q)
NB110-78644
Immunohistochemistry: HSD3B1 Antibody (FDO66Q) [NB110-78644] - Staining of placental villi.
(4 Publications)
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
17
beta-HSD1/HSD17B1 Ant ...
MAB7178
Western blot shows lysates of human placenta tissue. PVDF membrane was probed with 0.25 µg/mL of Mouse Anti-Human 17  beta ‑HSD1/HSD17B1 Monoclonal Antibody (Catalog # MAB7178) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). A specific band was detected for 17 beta ‑HSD1/HSD17B1 at approximately 35 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of human placenta tissue, loaded at 0.2 mg/mL. A specific band was detected for 17 beta ‑HSD1/HSD17B1 at approximately 40 kDa (as indicated) using 2.5 µg/mL of Mouse Anti-Human 17 beta ‑HSD1/HSD17B1 Monoclonal Antibody (Catalog # MAB7178). This experiment was conducted under reducing conditions and using the12-230 kDa separation system. Non-specific interaction with the 230 kDa Simple Western standard may be seen with this antibody.
(1 Review)
Species: Hu
Applications: WB, Simple Western

SF-1/NR5A1/Steroidogen ...
PP-N1665-00
SF-1/NR5A1/Steroidogenic Factor 1 Antibody (N1665)
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, IHC, IP
Ferredoxin
Reductase Antibody
NBP2-38530
Western Blot: Ferredoxin Reductase Antibody [NBP2-38530] - Analysis in human cell lines A-549 and U-251MG using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same cell lines. Loading control: anti-GAPDH.
Immunocytochemistry/Immunofluorescence: Ferredoxin Reductase Antibody [NBP2-38530] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemistry-Paraffin: Ferredoxin Reductase Antibody [NBP2-38530] - Staining in human adrenal gland and pancreas tissues using anti-FDXR antibody. Corresponding FDXR RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
ER beta/NR3A2
Antibody (14C8)
NB200-305
Western Blot: ER beta/NR3A2 Antibody (14C8) [NB200-305] - Non-transfected (-) and transfected (+) 293T whole cell extracts (30 ug) were separated by 7.5% SDS-PAGE, and the membrane was blotted with diluted at 1:5000.
Immunohistochemistry-Paraffin: Estrogen Receptor beta Antibody (14C8) [NB200-305] - Infiltrating lobular carcinoma of the breast.
(72 Publications)
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
AKR1B1 Antibody
NBP1-89146
Western Blot: AKR1B1 Antibody [NBP1-89146] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/Immunofluorescence: AKR1B1 Antibody [NBP1-89146] - Staining of human cell line A-431 shows localization to nucleoplasm & cytosol.
Immunohistochemistry-Paraffin: AKR1B1 Antibody [NBP1-89146] - Staining in human adrenal gland and cerebral cortex tissues using anti-AKR1B1 antibody. Corresponding AKR1B1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Beta
Hydroxysteroid Dehydr ...
NBP1-32353
Western Blot: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-32353] - Sample(30 ug of whole cell lysate)A:HeLa S3 (GTX14654)B:MOLT4(GTX27912)12% SDS PAGE, antibody diluted at 1:500.
Immunohistochemistry: Beta Hydroxysteroid Dehydrogenase Antibody [NBP1-32353] - Paraffin-embedded normal liver; antibody dilution 1:500.
(1 Review)
Species: Hu
Applications: WB, IHC, IHC-P
HSD17B2 Antibody
NBP1-92011
Western Blot: HSD17B2 Antibody [NBP1-92011] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/Immunofluorescence: HSD17B2 Antibody [NBP1-92011] - Staining of human cell line RT4 shows localization to endoplasmic reticulum.
Immunohistochemistry-Paraffin: HSD17B2 Antibody [NBP1-92011] - Staining in human duodenum and cerebral cortex tissues using anti-HSD17B2 antibody. Corresponding HSD17B2 RNA-seq data are presented for the same tissues.
(1 Publication)
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
PLOD1 Antibody
NBP2-38770
Western Blot: PLOD1 Antibody [NBP2-38770] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Immunohistochemistry-Paraffin: PLOD1 Antibody [NBP2-38770] - Staining of human placenta shows cytoplasmic positivity in decidual cells.
(2 Publications)
Species: Hu, Mu
Applications: WB, IHC, IHC-P
HSD17B12 Antibody
(4G11)
H00051144-M08
Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08] - Analysis of HSD17B12 expression in NIH/3T3.
Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08] - Analysis of HSD17B12 expression in PC-12.
Western Blot: HSD17B12 Antibody (4G11) [H00051144-M08] - Analysis of HSD17B12 expression in Jurkat (Cat # L017V1).
Species: Hu
Applications: WB, ELISA
CYP11B2 Antibody
NBP2-13891
Immunohistochemistry-Paraffin: CYP11B2 Antibody [NBP2-13891] - Staining of adrenal gland shows strong cytoplasmic positivity in cortical cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
HSD17B3 Antibody
H00003293-B01P
HSD17B3 Antibody
Species: Hu
Applications: WB

Publications for HSD17B3 Antibody (H00003293-B01P) (0)

There are no publications for HSD17B3 Antibody (H00003293-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD17B3 Antibody (H00003293-B01P) (0)

There are no reviews for HSD17B3 Antibody (H00003293-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSD17B3 Antibody (H00003293-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSD17B3 Products

Bioinformatics Tool for HSD17B3 Antibody (H00003293-B01P)

Discover related pathways, diseases and genes to HSD17B3 Antibody (H00003293-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSD17B3 Antibody (H00003293-B01P)

Discover more about diseases related to HSD17B3 Antibody (H00003293-B01P).
 

Pathways for HSD17B3 Antibody (H00003293-B01P)

View related products by pathway.

PTMs for HSD17B3 Antibody (H00003293-B01P)

Learn more about PTMs related to HSD17B3 Antibody (H00003293-B01P).
 

Research Areas for HSD17B3 Antibody (H00003293-B01P)

Find related products by research area.

Blogs on HSD17B3

There are no specific blogs for HSD17B3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSD17B3 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol HSD17B3
Entrez
Uniprot