HSD17B3 Antibody

Images

 
Western Blot: HSD17B3 Antibody [H00003293-B01P] - Analysis of HSD17B3 expression in transfected 293T cell line by HSD17B3 polyclonal antibody. Lane1:HSD17B3 transfected lysate(34.1 KDa). Lane2:Non-transfected lysate.
Western Blot: HSD17B3 Antibody [H00003293-B01P] - analysis of HSD17B3 expression in transfected 293T cell line by HSD17B3 MaxPab polyclonal antibody. Lane1: HSD17B3 transfected lysate (34.1 KDa). Lane2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HSD17B3 Antibody Summary

Immunogen
HSD17B3 (NP_000188.1, 1 a.a. - 310 a.a.) full-length human protein. MGDVLEQFFILTGLLVCLACLAKCVRFSRCVLLNYWKVLPKSFLRSMGQWAVITGAGDGIGKAYSFELAKRGLNVVLISRTLEKLEAIATEIERTTGRSVKIIQADFTKDDIYEHIKEKLAGLEIGILVNNVGMLPNLLPSHFLNAPDEIQSLIHCNITSVVKMTQLILKHMESRQKGLILNISSGIALFPWPLYSMYSASKAFVCAFSKALQEEYKAKEVIIQVLTPYAVSTAMTKYLNTNVITKTADEFVKESLNYVTIGGETCGCLAHEILAGFLSLIPAWAFYSGAFQRLLLTHYVAYLKLNTKVR
Specificity
HSD17B3 - hydroxysteroid (17-beta) dehydrogenase 3,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
HSD17B3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein A purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HSD17B3 Antibody

  • EC 1.1.1.64
  • EDH17B317-beta-HSD3
  • hydroxysteroid (17-beta) dehydrogenase 3,17-beta-hydroxysteroid dehydrogenase type 3
  • SDR12C2
  • short chain dehydrogenase/reductase family 12C, member 2
  • Testicular 17-beta-hydroxysteroid dehydrogenase
  • testosterone 17-beta-dehydrogenase 3,17-beta-HSD 3

Background

This isoform of 17 beta-hydroxysteroid dehydrogenase is expressed predominantly in the testis and catalyzes the conversion of androstenedione to testosterone. It preferentially uses NADP as cofactor. Deficiency can result in male pseudohermaphroditism with gynecomastia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01151
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP1-54758
Species: Hu
Applications: WB, IHC, IHC-P
NB100-1596
Species: Hu, Pm, Rb
Applications: WB, ICC/IF, IHC
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-46510
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB110-78644
Species: Hu, Rt, Bb, Bv, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB7178
Species: Hu
Applications: WB, Simple Western
PP-N1665-00
Species: Hu
Applications: WB, IHC, IP
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB200-305
Species: Hu, Mu, Mk
Applications: WB, ChIP, DB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32353
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-92011
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00051144-M08
Species: Hu
Applications: WB, ELISA
NBP1-56518
Species: Hu
Applications: WB
H00003293-B01P
Species: Hu
Applications: WB

Publications for HSD17B3 Antibody (H00003293-B01P) (0)

There are no publications for HSD17B3 Antibody (H00003293-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HSD17B3 Antibody (H00003293-B01P) (0)

There are no reviews for HSD17B3 Antibody (H00003293-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSD17B3 Antibody (H00003293-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HSD17B3 Products

Bioinformatics Tool for HSD17B3 Antibody (H00003293-B01P)

Discover related pathways, diseases and genes to HSD17B3 Antibody (H00003293-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSD17B3 Antibody (H00003293-B01P)

Discover more about diseases related to HSD17B3 Antibody (H00003293-B01P).
 

Pathways for HSD17B3 Antibody (H00003293-B01P)

View related products by pathway.

PTMs for HSD17B3 Antibody (H00003293-B01P)

Learn more about PTMs related to HSD17B3 Antibody (H00003293-B01P).
 

Research Areas for HSD17B3 Antibody (H00003293-B01P)

Find related products by research area.

Blogs on HSD17B3

There are no specific blogs for HSD17B3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSD17B3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD17B3
Entrez
Uniprot