HSD17B12 Antibody

Images

 
Orthogonal Strategies: Western Blot: HSD17B12 Antibody [NBP1-81567] - Analysis in human cell lines U-251MG and HeLa. Corresponding RNA-seq data are presented for the same cell lines. Loading control: Anti-HSP90B1.
Immunohistochemistry-Paraffin: HSD17B12 Antibody [NBP1-81567] - Staining of human colon shows moderate to strong cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HSD17B12 Antibody [NBP1-81567] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Immunohistochemistry-Paraffin: HSD17B12 Antibody [NBP1-81567] - Staining of human testis shows strong cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: HSD17B12 Antibody [NBP1-81567] - Staining of human lung shows strong cytoplasmic positivity in macrophages.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

HSD17B12 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: WGVGNEAGVGPGLGEWAVVTGSTDGIGKSYAEELAKHGMKVVLISRSKDKLDQVSSEIKEKFKVETRTIAVDFASEDIYDKIKTGLAGLEIGILVNNVGMSYEYPEYFLDVPDLD
Specificity
Specificity of human HSD17B12 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HSD17B12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HSD17B12 Protein (NBP1-81567PEP)
Publications
Read Publication using
NBP1-81567 in the following applications:

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HSD17B12 Antibody

  • 17-beta-HSD 12
  • 17-beta-hydroxysteroid dehydrogenase 12
  • EC 1.1.1.62,3-ketoacyl-CoA reductase
  • EC 1.3.1.-
  • hydroxysteroid (17-beta) dehydrogenase 12,17beta-HSD type 12
  • KARestradiol 17-beta-dehydrogenase 12
  • SDR12C1
  • short chain dehydrogenase/reductase family 12C, member 1
  • steroid dehydrogenase homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91946
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-76849
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-76852
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88227
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-76853
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-88191
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-61782
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB12251
Species: Hu
Applications: Flow, CyTOF-ready
NBP1-58906
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-82026
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-75510
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB1058
Species: Hu
Applications: Flow, Block, CyTOF-ready
H00003292-M03
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
MAB2014
Species: Hu
Applications: Flow, CyTOF-reported
NBP2-41134
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-31378
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NLS921
Species: Hu, Bv
Applications: WB, IHC, IHC-P, ICC
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-16884
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81567
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HSD17B12 Antibody (NBP1-81567)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for HSD17B12 Antibody (NBP1-81567) (0)

There are no reviews for HSD17B12 Antibody (NBP1-81567). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HSD17B12 Antibody (NBP1-81567) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HSD17B12 Products

Bioinformatics Tool for HSD17B12 Antibody (NBP1-81567)

Discover related pathways, diseases and genes to HSD17B12 Antibody (NBP1-81567). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HSD17B12 Antibody (NBP1-81567)

Discover more about diseases related to HSD17B12 Antibody (NBP1-81567).
 

Pathways for HSD17B12 Antibody (NBP1-81567)

View related products by pathway.

Blogs on HSD17B12

There are no specific blogs for HSD17B12, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HSD17B12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HSD17B12