HS3ST3A1 Antibody - Azide and BSA Free

Western Blot: HS3ST3A1 Antibody [NBP3-05038] - Analysis of extracts of U-251MG cells, using HS3ST3A1 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HS3ST3A1 Antibody - Azide and BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 44-140 of human HS3ST3A1 (NP_006033.1). ERCQTLSGPVVGLSGGGEEAGAPGGGVLAGGPRELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEESPGLSGGPGGSGAGSTVAEAPPGT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HS3ST3A1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 44 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for HS3ST3A1 Antibody - Azide and BSA Free

• 3-OST-3A
• 3OST3A1heparan sulfate glucosamine 3-O-sulfotransferase 3A1,30ST3A1heparin-glucosamine 3-O-sulfotransferase
• EC 2.8.2
• EC 2.8.2.30
• h3-OST-3A
• heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1
• Heparan sulfate 3-O-sulfotransferase 3A1
• Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1
• HS3ST3A

Background

HS3ST3A1 codes for a protein with a length of 406 amino acids and a weight of approximately 45 kDa, that is a sulfotransferase that utilizes PAPS to facilitate in the transfer of a sulfo group to a glucosamine on heparan sulfate, which causes the heparan sulfate to become enzyme-modified and acts as a binding receptor to HSV-1 and permits its entry, and is most abundant in the heart and placenta. Current studies are being done on diseases and disorders relating to this gene including recurrent respiratory papillomatosis, herpes simplex, and scoliosis. HS3ST3A1 has also been shown to have interactions with EXT1, EXT2, GLCE, GPC1, and GPC2 in pathways such as the heparan sulfate biosynthesis, metapathway biotransformation, Maroteauc-Lamy syndrome, metabolism, and Hunter syndrome pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: HS3ST3A1