HS3ST3A1 Antibody - BSA Free Summary
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEES |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HS3ST3A1 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
|
| Application Notes |
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for HS3ST3A1 Antibody - BSA Free
Background
HS3ST3A1 codes for a protein with a length of 406 amino acids and a weight of approximately 45 kDa, that is a sulfotransferase that utilizes PAPS to facilitate in the transfer of a sulfo group to a glucosamine on heparan sulfate, which causes the heparan sulfate to become enzyme-modified and acts as a binding receptor to HSV-1 and permits its entry, and is most abundant in the heart and placenta. Current studies are being done on diseases and disorders relating to this gene including recurrent respiratory papillomatosis, herpes simplex, and scoliosis. HS3ST3A1 has also been shown to have interactions with EXT1, EXT2, GLCE, GPC1, and GPC2 in pathways such as the heparan sulfate biosynthesis, metapathway biotransformation, Maroteauc-Lamy syndrome, metabolism, and Hunter syndrome pathways.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: IP, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ELISA, WB
Species: Hu
Applications: IHC, IP
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: CyTOF-ready, Flow, ICC, Neut
Species: Hu
Applications: EnzAct
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Hu
Applications: ICC/IF
Publications for HS3ST3A1 Antibody (NBP2-56398) (0)
There are no publications for HS3ST3A1 Antibody (NBP2-56398).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HS3ST3A1 Antibody (NBP2-56398) (0)
There are no reviews for HS3ST3A1 Antibody (NBP2-56398).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HS3ST3A1 Antibody (NBP2-56398) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HS3ST3A1 Products
Research Areas for HS3ST3A1 Antibody (NBP2-56398)
Find related products by research area.
|
Blogs on HS3ST3A1