HS3ST3A1 Antibody


Immunocytochemistry/ Immunofluorescence: HS3ST3A1 Antibody [NBP2-56398] - Staining of human cell line U-2 OS shows localization to microtubules.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

HS3ST3A1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEES
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HS3ST3A1 Recombinant Protein Antigen (NBP2-56398PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for HS3ST3A1 Antibody

  • 3-OST-3A
  • 3OST3A1heparan sulfate glucosamine 3-O-sulfotransferase 3A1,30ST3A1heparin-glucosamine 3-O-sulfotransferase
  • EC 2.8.2
  • EC
  • h3-OST-3A
  • heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1
  • Heparan sulfate 3-O-sulfotransferase 3A1
  • Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1
  • HS3ST3A


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IP
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, IHC
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Mu
Applications: Flow, IHC, CyTOF-ready
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
Species: Mu, Rt
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
Species: Hu
Applications: ICC/IF

Publications for HS3ST3A1 Antibody (NBP2-56398) (0)

There are no publications for HS3ST3A1 Antibody (NBP2-56398).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HS3ST3A1 Antibody (NBP2-56398) (0)

There are no reviews for HS3ST3A1 Antibody (NBP2-56398). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HS3ST3A1 Antibody (NBP2-56398) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional HS3ST3A1 Products

Bioinformatics Tool for HS3ST3A1 Antibody (NBP2-56398)

Discover related pathways, diseases and genes to HS3ST3A1 Antibody (NBP2-56398). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HS3ST3A1 Antibody (NBP2-56398)

Discover more about diseases related to HS3ST3A1 Antibody (NBP2-56398).

Pathways for HS3ST3A1 Antibody (NBP2-56398)

View related products by pathway.

PTMs for HS3ST3A1 Antibody (NBP2-56398)

Learn more about PTMs related to HS3ST3A1 Antibody (NBP2-56398).

Blogs on HS3ST3A1

There are no specific blogs for HS3ST3A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HS3ST3A1 Antibody and receive a gift card or discount.


Gene Symbol HS3ST3A1