HS3ST3A1 Antibody

Images

 
Western Blot: HS3ST3A1 Antibody [NBP2-49661] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10Lane 2: Human cell line RT-4Lane 3: Human cell line U-251 MGLane 4: Human plasmaLane 5: Human Liver tissueLane 6: ...read more
Immunohistochemistry: HS3ST3A1 Antibody [NBP2-49661] - Staining of human heart muscle shows moderate cytoplasmic positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HS3ST3A1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: RELAVWPAAAQRKRLLQLPQWRRRRPPAPRDDGEEAAWEEES
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HS3ST3A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HS3ST3A1 Recombinant Protein Antigen (NBP2-49661PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HS3ST3A1 Antibody

  • 3-OST-3A
  • 3OST3A1heparan sulfate glucosamine 3-O-sulfotransferase 3A1,30ST3A1heparin-glucosamine 3-O-sulfotransferase
  • EC 2.8.2
  • EC 2.8.2.30
  • h3-OST-3A
  • heparan sulfate (glucosamine) 3-O-sulfotransferase 3A1
  • Heparan sulfate 3-O-sulfotransferase 3A1
  • Heparan sulfate D-glucosaminyl 3-O-sulfotransferase 3A1
  • HS3ST3A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5968
Species: Hu
Applications: WB, IP
NBP2-16880
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
H00007357-M03
Species: Hu
Applications: WB, ELISA
AF6085
Species: Hu, Mu
Applications: WB, IHC
NBP1-05034
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
MAB7089
Species: Mu
Applications: Flow, IHC, CyTOF-ready
MAB182
Species: Hu
Applications: Flow, CyTOF-ready, ICC, Neut
NBP2-92274
Species: Mu, Rt
Applications: WB, ICC/IF
NBP1-87174
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NBP2-45731
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
NBP1-87757
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
NBP2-49661
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HS3ST3A1 Antibody (NBP2-49661) (0)

There are no publications for HS3ST3A1 Antibody (NBP2-49661).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HS3ST3A1 Antibody (NBP2-49661) (0)

There are no reviews for HS3ST3A1 Antibody (NBP2-49661). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HS3ST3A1 Antibody (NBP2-49661) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HS3ST3A1 Products

Bioinformatics Tool for HS3ST3A1 Antibody (NBP2-49661)

Discover related pathways, diseases and genes to HS3ST3A1 Antibody (NBP2-49661). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HS3ST3A1 Antibody (NBP2-49661)

Discover more about diseases related to HS3ST3A1 Antibody (NBP2-49661).
 

Pathways for HS3ST3A1 Antibody (NBP2-49661)

View related products by pathway.

PTMs for HS3ST3A1 Antibody (NBP2-49661)

Learn more about PTMs related to HS3ST3A1 Antibody (NBP2-49661).

Blogs on HS3ST3A1

There are no specific blogs for HS3ST3A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HS3ST3A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HS3ST3A1