HPSE2 Antibody

Images

 
Western Blot: HPSE2 Antibody [NBP2-83063] - Host: Rabbit. Target Name: HPSE2. Sample Type: MCF7 Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HPSE2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human HPSE2. Peptide sequence: LVTLARGLSPAFLRFGGKRTDFLQFQNLRNPAKSRGGPGPDYYLKNYEDD The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
HPSE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HPSE2 Antibody

  • heparanase 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

7570-GH
Species: Hu
Applications: EnzAct
NBP1-90267
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NB100-174
Species: Ha, Hu, Pm, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NBP1-31336
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF2780
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
AF5747
Species: Hu, Mu, Rt
Applications: IHC, WB
AF1034
Species: Mu, Rt
Applications: IHC, Simple Western, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
538-MG
Species: Rt
Applications: BA
H00009033-M01
Species: Hu, Mu, Rt
Applications: ELISA, PAGE, WB
MAB25031
Species: Hu
Applications: IHC, IP, WB
NBP1-78159
Species: Bv, Hu, Po, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA, WB
AF743
Species: Mu
Applications: CyTOF-ready, Flow, WB
AF4779
Species: Hu
Applications: IHC, WB
NBP2-24613
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NB100-2564
Species: Hu
Applications: WB
NBP2-17017
Species: Hu, Mu
Applications: ICC/IF, WB
NB120-495
Species: Dr, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-83063
Species: Hu
Applications: WB

Publications for HPSE2 Antibody (NBP2-83063) (0)

There are no publications for HPSE2 Antibody (NBP2-83063).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HPSE2 Antibody (NBP2-83063) (0)

There are no reviews for HPSE2 Antibody (NBP2-83063). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HPSE2 Antibody (NBP2-83063) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HPSE2 Products

Bioinformatics Tool for HPSE2 Antibody (NBP2-83063)

Discover related pathways, diseases and genes to HPSE2 Antibody (NBP2-83063). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HPSE2 Antibody (NBP2-83063)

Discover more about diseases related to HPSE2 Antibody (NBP2-83063).
 

Pathways for HPSE2 Antibody (NBP2-83063)

View related products by pathway.

PTMs for HPSE2 Antibody (NBP2-83063)

Learn more about PTMs related to HPSE2 Antibody (NBP2-83063).

Blogs on HPSE2

There are no specific blogs for HPSE2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HPSE2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HPSE2