HPS4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: HPS4 Antibody [NBP2-31898] - Immunofluorescent staining of human cell line A-431 shows localization to centrosome.
Immunohistochemistry: HPS4 Antibody [NBP2-31898] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HPS4 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: GQRGNKLPTGEQGLDEDVDGVCESHAAPGLECSSGSANCQGAGPSADGISSRLTPAESCMGLVRMNLYTHCVKGLVLSLLAEEPLLGDSAAIEEVYHSSLASLNGLEVHLKETLPRDEAASTSSTYNFTHYDR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HPS4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HPS4 Protein (NBP2-31898PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HPS4 Antibody

  • bK1048E9.4
  • Hermansky-Pudlak syndrome 4 protein
  • Hermansky-Pudlak syndrome 4
  • KIAA1667bK1048E9.5
  • LE
  • Light-ear protein homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB120-15200
Species: Hu, Mu, Sh
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-59320
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC
NBP1-48002
Species: Hu, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB500-525
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP1-81746
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02623
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NB200-540
Species: Mu
Applications: WB, Flow, IA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
NB120-11012
Species: Hu, Bv(-), Ca(-), Eq(-), Gp(-), Mu(-), Po(-)
Applications: WB, ELISA, ICC/IF, IP
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
NBP2-31898
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for HPS4 Antibody (NBP2-31898) (0)

There are no publications for HPS4 Antibody (NBP2-31898).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HPS4 Antibody (NBP2-31898) (0)

There are no reviews for HPS4 Antibody (NBP2-31898). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for HPS4 Antibody (NBP2-31898) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HPS4 Products

Bioinformatics Tool for HPS4 Antibody (NBP2-31898)

Discover related pathways, diseases and genes to HPS4 Antibody (NBP2-31898). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HPS4 Antibody (NBP2-31898)

Discover more about diseases related to HPS4 Antibody (NBP2-31898).
 

Pathways for HPS4 Antibody (NBP2-31898)

View related products by pathway.

PTMs for HPS4 Antibody (NBP2-31898)

Learn more about PTMs related to HPS4 Antibody (NBP2-31898).

Blogs on HPS4

There are no specific blogs for HPS4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HPS4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HPS4
Uniprot