HOOK1 Antibody

Images

 
Western Blot: HOOK1 Antibody [NBP1-81744] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: HOOK1 Antibody [NBP1-81744] - Staining in human testis and endometrium tissues using anti-HOOK1 antibody. Corresponding HOOK1 RNA-seq data are presented for the same tissues.
Western Blot: HOOK1 Antibody [NBP1-81744] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: HOOK1 Antibody [NBP1-81744] - Staining of human endometrium shows low expression as expected.
Immunohistochemistry-Paraffin: HOOK1 Antibody [NBP1-81744] - Staining of human testis shows high expression.

Product Details

Summary
Reactivity Hu, Rt, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HOOK1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: AFEMKRLEEKHEALLKEKERLIEQRDTLKETNEELRCSQVQQDHLNQTDASATKSYENLAAEIMPVEYREVFIRLQHENKMLRLQQEGSENERIEELQE
Specificity
Specificity of human, rat HOOK1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (94%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HOOK1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HOOK1 Protein (NBP1-81744PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HOOK1 Antibody

  • hHK1
  • HK1h-hook1
  • hook homolog 1 (Drosophila)
  • MGC10642
  • protein Hook homolog 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-02272
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
MAB2337
Species: Hu
Applications: WB, IP
NBP2-14986
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-06046
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB500-180
Species: Hu, Mu, Rt, Po, Ma
Applications: WB, Simple Western, ICC/IF, IP
NBP2-33891
Species: Hu
Applications: IHC, IHC-P
NBP2-29429
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC, Single Cell Western
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Flow-IC
NB100-695
Species: Hu, Av, Bv, Fi, Ma, Re
Applications: WB, ELISA, IHC
NBP1-47778
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-81743
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-38799
Species: Hu
Applications: WB, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-89993
Species: Hu
Applications: WB, IHC, IHC-P
MAB1569
Species: Hu
Applications: WB, IHC, IP
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-81744
Species: Hu, Rt, Mu
Applications: WB, IHC, IHC-P

Publications for HOOK1 Antibody (NBP1-81744) (0)

There are no publications for HOOK1 Antibody (NBP1-81744).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HOOK1 Antibody (NBP1-81744) (0)

There are no reviews for HOOK1 Antibody (NBP1-81744). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HOOK1 Antibody (NBP1-81744) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for HOOK1 Antibody (NBP1-81744)

Discover related pathways, diseases and genes to HOOK1 Antibody (NBP1-81744). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HOOK1 Antibody (NBP1-81744)

Discover more about diseases related to HOOK1 Antibody (NBP1-81744).
 

Pathways for HOOK1 Antibody (NBP1-81744)

View related products by pathway.

Blogs on HOOK1

There are no specific blogs for HOOK1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HOOK1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HOOK1