Genetic Strategies: Western Blot: hnRNP U Antibody [NBP2-49290] - Analysis in U2OS cells transfected with control siRNA, target specific siRNA probe #1 and #2. Remaining relative intensity is presented.
Immunocytochemistry/ Immunofluorescence: hnRNP U Antibody [NBP2-49290] - Staining of human cell line Hep G2 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-49290] - Staining of human skeletal muscle shows moderate nuclear positivity in myocytes.
Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-49290] - Staining of human cerebral cortex shows strong nuclear positivity in neurons.
Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-49290] - Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.
Immunohistochemistry-Paraffin: hnRNP U Antibody [NBP2-49290] - Staining of human prostate shows strong nuclear positivity in glandular cells.
Novus Biologicals Rabbit hnRNP U Antibody - BSA Free (NBP2-49290) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-hnRNP U Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: AVLKMKGNFTLPEVAECFDEITYVELQKEEAQKLLEQYKEESKKALPPEKKQNTGSKKSNKNKSGKNQFNRGGGHRGRGGFNMRGG
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNRNPU
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Mouse reactivity reported in the scientific literature (PMID: 30044993)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for hnRNP U Antibody - BSA Free
heterogeneous nuclear ribonucleoprotein U (scaffold attachment factor A)
heterogeneous nuclear ribonucleoprotein U
hnRNP U
HNRPU
p120 nuclear protein
p120
pp120
SAFA
SAF-AhnRNPU
Scaffold attachment factor A
U21.1
Background
hnRNP U belongs to the subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they form complexes with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene contains a RNA binding domain and scaffold-associated region (SAR)-specific bipartite DNA-binding domain. This protein is also thought to be involved in the packaging of hnRNA into large ribonucleoprotein complexes. During apoptosis, this protein is cleaved in a caspase-dependent way. Cleavage occurs at the SALD site, resulting in a loss of DNA-binding activity and a concomitant detachment of this protein from nuclear structural sites. But this cleavage does not affect the function of the encoded protein in RNA metabolism. At least two alternatively spliced transcript variants have been identified for this gene.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our hnRNP U Antibody - BSA Free and receive a gift card or discount.