hnRNP H Antibody - BSA Free

Western Blot: hnRNP H Antibody [NBP2-86668] - Host: Rabbit. Target Name: HNRNPH1. Sample Tissue: HepG2 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

hnRNP H Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human hnRNP H. Peptide sequence: GEGFVVKVRGLPWSCSADEVQRFFSDCKIQNGAQGIRFIYTREGRPSGEA The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HNRNPH1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for hnRNP H Antibody - BSA Free

• DKFZp686A15170
• heterogeneous nuclear ribonucleoprotein H
• heterogeneous nuclear ribonucleoprotein H1 (H)
• hnRNP H
• HNRPH
• HNRPH1hnRNPH

Background

The heterogeneous nuclear Ribonucleoprotein (hnRNP) H protein family is involved in pre-mRNA processing. It is essential for enhancer activity. The sequence GGGA is recognized by all hnRNP H family proteins. Mutant exon 6D sequences function as a splicing enhancer when inserted into an enhancer-dependent splicing construct. hnRNP H family proteins bind to the enhancer and their binding is dependent on the sequence GGGA, located just downstream of the point of mutation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HNRNPH1