ILF2 Antibody

Images

 
Western Blot: ILF2 Antibody [NBP1-82586] - Analysis in HEK293 cells transfected with control siRNA, target specific siRNA probe #1, using Anti-ILF2 antibody. Remaining relative intensity is presented. Loading control: ...read more
Immunocytochemistry/ Immunofluorescence: ILF2 Antibody [NBP1-82586] - Staining of human cell line U-251 MG shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: ILF2 Antibody [NBP1-82586] - Staining of human colon shows strong nuclear positivity in glandular cells.
Western Blot: ILF2 Antibody [NBP1-82586] - Analysis in human cell line HEK 293.
Western Blot: ILF2 Antibody [NBP1-82586] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
     

Genetic Strategies

   

Order Details

ILF2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PFDFYLCEMAFPRVKPAPDETSFSEALLKRNQDLAPNSAEQASILSLVTKINNVIDNLIVAPGTFEVQIEEVRQVGSYKKGTMTTGHNVADLVVILKILPTLEAVAALGNKVVESLRAQDPSEVLTMLTNETGFEISSSDATV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ILF2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ILF2 Protein (NBP1-82586PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ILF2 Antibody

  • interleukin enhancer binding factor 2, 45kD
  • interleukin enhancer binding factor 2, 45kDa
  • interleukin enhancer-binding factor 2
  • MGC8391
  • NF45PRO3063
  • Nuclear factor of activated T-cells 45 kDa
  • nuclear factor of activated T-cells, 45-kDa

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84056
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-02456
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-77266
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF8519
Species: Hu, Mu, Rt
Applications: WB
NBP2-37583
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF3235
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-83754
Species: Hu
Applications: IHC, IHC-P
NB110-40579
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00006607-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-41201
Species: Hu
Applications: WB, ChIP, ICC/IF, IHC, IP
NB120-11433
Species: Hu, Mu, Rt, Ye
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-18910
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-89606
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1915
Species: Hu, Mu, Rt, Ha, Pm, Xp
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB120-3562
Species: Hu, Mu, Rt, Bv, Ch, Pm, Rb
Applications: WB, Flow, GS, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for ILF2 Antibody (NBP1-82586) (0)

There are no publications for ILF2 Antibody (NBP1-82586).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ILF2 Antibody (NBP1-82586) (0)

There are no reviews for ILF2 Antibody (NBP1-82586). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for ILF2 Antibody (NBP1-82586). (Showing 1 - 1 of 1 FAQ).

  1. I bought an anti-ILF2 antibody (NBP1-82586, lot A83191) from you. I need to know the concentration of this antibody by the fact that is not written on the label.
    • Lot A83191 of NBP1-82586 is at a concentration of 0.2mg/ml.

Secondary Antibodies

 

Isotype Controls

Additional ILF2 Products

Bioinformatics Tool for ILF2 Antibody (NBP1-82586)

Discover related pathways, diseases and genes to ILF2 Antibody (NBP1-82586). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ILF2 Antibody (NBP1-82586)

Discover more about diseases related to ILF2 Antibody (NBP1-82586).
 

Pathways for ILF2 Antibody (NBP1-82586)

View related products by pathway.

PTMs for ILF2 Antibody (NBP1-82586)

Learn more about PTMs related to ILF2 Antibody (NBP1-82586).

Blogs on ILF2

There are no specific blogs for ILF2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ILF2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ILF2