hnRNP A2B1 Antibody

Images

 
Western Blot: hnRNP A2B1 Antibody [NBP1-89675] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunohistochemistry-Paraffin: hnRNP A2B1 Antibody [NBP1-89675] - Staining of human placenta shows strong nuclear positivity in trophoblastic cells.
Western Blot: hnRNP A2B1 Antibody [NBP1-89675] - Analysis in human cell line Daudi.
Immunohistochemistry-Paraffin: hnRNP A2B1 Antibody [NBP1-89675] - Staining of human testis shows strong nuclear positivity in cells of seminiferus ducts.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

hnRNP A2B1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKAL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNRNPA2B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
hnRNP A2B1 Protein (NBP1-89675PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for hnRNP A2B1 Antibody

  • DKFZp779B0244
  • FLJ22720
  • heterogeneous nuclear ribonucleoprotein A2/B1
  • heterogeneous nuclear ribonucleoprotein B1
  • heterogeneous nuclear ribonucleoproteins A2/B1
  • hnRNP A2 / hnRNP B1
  • HNRNPA2
  • HNRNPB1
  • HNRPA2
  • HNRPA2B1hnRNP A2/B1
  • HNRPB1
  • nuclear ribonucleoprotein particle A2 protein
  • RNPA2
  • SNRPB1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83228
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00027161-M01
Species: Hu, Mu, Rt
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, RNAi
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
NB300-223
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB100-233
Species: Hu
Applications: WB, PLA
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP

Publications for hnRNP A2B1 Antibody (NBP1-89675) (0)

There are no publications for hnRNP A2B1 Antibody (NBP1-89675).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hnRNP A2B1 Antibody (NBP1-89675) (0)

There are no reviews for hnRNP A2B1 Antibody (NBP1-89675). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for hnRNP A2B1 Antibody (NBP1-89675) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional hnRNP A2B1 Products

Bioinformatics Tool for hnRNP A2B1 Antibody (NBP1-89675)

Discover related pathways, diseases and genes to hnRNP A2B1 Antibody (NBP1-89675). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hnRNP A2B1 Antibody (NBP1-89675)

Discover more about diseases related to hnRNP A2B1 Antibody (NBP1-89675).
 

Pathways for hnRNP A2B1 Antibody (NBP1-89675)

View related products by pathway.

PTMs for hnRNP A2B1 Antibody (NBP1-89675)

Learn more about PTMs related to hnRNP A2B1 Antibody (NBP1-89675).
 

Research Areas for hnRNP A2B1 Antibody (NBP1-89675)

Find related products by research area.

Blogs on hnRNP A2B1

There are no specific blogs for hnRNP A2B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our hnRNP A2B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRNPA2B1