hnRNP A2B1 Antibody

Images

 
Western Blot: hnRNP A2B1 Antibody [NBP1-57166] - Jurkat cell lysate, concentration 0.2-1 ug/ml.
Immunohistochemistry: hnRNP A2B1 Antibody [NBP1-57166] - Human Heart cell Cellular data: cardiac cell of renal tubule Antibody Concentration: 4.0-8.0 ug/ml Magnification: 400X.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

hnRNP A2B1 Antibody Summary

Immunogen
Synthetic peptides corresponding to HNRNPA2B1(heterogeneous nuclear ribonucleoprotein A2/B1) The peptide sequence was selected from the N terminal of HNRNPA2B1. Peptide sequence MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDC.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HNRNPA2B1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry
Application Notes
This is a rabbit polyclonal antibody against HNRNPA2B1 and was validated on Western blot.
Control
hnRNP A2B1 Lysate (NBP2-65740)

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for hnRNP A2B1 Antibody

  • DKFZp779B0244
  • FLJ22720
  • heterogeneous nuclear ribonucleoprotein A2/B1
  • heterogeneous nuclear ribonucleoprotein B1
  • heterogeneous nuclear ribonucleoproteins A2/B1
  • hnRNP A2 / hnRNP B1
  • HNRNPA2
  • HNRNPB1
  • HNRPA2
  • HNRPA2B1hnRNP A2/B1
  • HNRPB1
  • nuclear ribonucleoprotein particle A2 protein
  • RNPA2
  • SNRPB1

Background

HNRNPA2B1 belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. HNRNPA2B1 has two repeats of quasi-RRM domains that bind to RNAs.This gene belongs to the A/B subfamily of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs). The hnRNPs are RNA binding proteins and they complex with heterogeneous nuclear RNA (hnRNA). These proteins are associated with pre-mRNAs in the nucleus and appear to influence pre-mRNA processing and other aspects of mRNA metabolism and transport. While all of the hnRNPs are present in the nucleus, some seem to shuttle between the nucleus and the cytoplasm. The hnRNP proteins have distinct nucleic acid binding properties. The protein encoded by this gene has two repeats of quasi-RRM domains that bind to RNAs. This gene has been described to generate two alternatively spliced transcript variants which encode different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP2-67656
Species: Hu, Mu, Rt, Ze
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB100-672
Species: Hu, Mu, Bv, Ca
Applications: WB, ELISA, ICC/IF, IP, MiAr
NBP2-38806
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83228
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-67121
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00005725-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
NB100-56583
Species: Hu, Rb
Applications: WB, Flow, IHC-P
NB300-223
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq
Applications: WB, ICC/IF, ICC
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
AF6457
Species: Hu
Applications: WB
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP
NBP2-48927
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Fe, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP

Publications for hnRNP A2B1 Antibody (NBP1-57166) (0)

There are no publications for hnRNP A2B1 Antibody (NBP1-57166).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for hnRNP A2B1 Antibody (NBP1-57166) (0)

There are no reviews for hnRNP A2B1 Antibody (NBP1-57166). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for hnRNP A2B1 Antibody (NBP1-57166) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for hnRNP A2B1 Antibody (NBP1-57166)

Discover related pathways, diseases and genes to hnRNP A2B1 Antibody (NBP1-57166). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for hnRNP A2B1 Antibody (NBP1-57166)

Discover more about diseases related to hnRNP A2B1 Antibody (NBP1-57166).
 

Pathways for hnRNP A2B1 Antibody (NBP1-57166)

View related products by pathway.

PTMs for hnRNP A2B1 Antibody (NBP1-57166)

Learn more about PTMs related to hnRNP A2B1 Antibody (NBP1-57166).
 

Research Areas for hnRNP A2B1 Antibody (NBP1-57166)

Find related products by research area.

Blogs on hnRNP A2B1

There are no specific blogs for hnRNP A2B1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our hnRNP A2B1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HNRNPA2B1
Uniprot