HN1 Antibody

Images

 
Western Blot: HN1 Antibody [NBP2-32492] - Analysis in human cell line PC-3.
Immunocytochemistry/ Immunofluorescence: HN1 Antibody [NBP2-32492] - Immunofluorescent staining of human cell line A549 shows localization to nucleus & nuclear membrane.
Immunohistochemistry: HN1 Antibody [NBP2-32492] - Staining of liver cancer.
Immunocytochemistry/ Immunofluorescence: HN1 Antibody [NBP2-32492] - Staining of human cell line A549 shows positivity in nucleus and nuclear membrane.
Immunohistochemistry: HN1 Antibody [NBP2-32492] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.
Immunohistochemistry: HN1 Antibody [NBP2-32492] - Staining of cerebellum.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HN1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQASWAKS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HN1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
HN1 Protein (NBP2-32492PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HN1 Antibody

  • Androgen-regulated protein 2
  • ARM2hematological and neurological expressed 1 protein
  • hematological and neurological expressed 1
  • HN1A
  • OPMRX60

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB35661
Species: Hu
Applications: WB, IHC, IP, Neut
NBP1-30447
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
MAB4620
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
NBP1-80295
Species: Hu
Applications: WB
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
NBP2-46360
Species: Hu
Applications: WB, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-01225
Species: Hu
Applications: WB, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB110-85538
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
AF1190
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NB600-335
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
NBP2-22617
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NBP2-32492
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HN1 Antibody (NBP2-32492) (0)

There are no publications for HN1 Antibody (NBP2-32492).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HN1 Antibody (NBP2-32492) (0)

There are no reviews for HN1 Antibody (NBP2-32492). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HN1 Antibody (NBP2-32492) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HN1 Products

Bioinformatics Tool for HN1 Antibody (NBP2-32492)

Discover related pathways, diseases and genes to HN1 Antibody (NBP2-32492). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HN1 Antibody (NBP2-32492)

Discover more about diseases related to HN1 Antibody (NBP2-32492).
 

Pathways for HN1 Antibody (NBP2-32492)

View related products by pathway.

PTMs for HN1 Antibody (NBP2-32492)

Learn more about PTMs related to HN1 Antibody (NBP2-32492).
 

Research Areas for HN1 Antibody (NBP2-32492)

Find related products by research area.

Blogs on HN1

There are no specific blogs for HN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HN1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HN1