HN1 Antibody


Western Blot: HN1 Antibody [NBP2-32492] - Analysis in human cell line PC-3.
Immunocytochemistry/ Immunofluorescence: HN1 Antibody [NBP2-32492] - Immunofluorescent staining of human cell line A549 shows localization to nucleus & nuclear membrane.
Immunohistochemistry: HN1 Antibody [NBP2-32492] - Staining of liver cancer.
Immunocytochemistry/ Immunofluorescence: HN1 Antibody [NBP2-32492] - Staining of human cell line A549 shows positivity in nucleus and nuclear membrane.
Immunohistochemistry: HN1 Antibody [NBP2-32492] - Staining of human testis shows moderate nuclear positivity in cells in seminiferus ducts.
Immunohistochemistry: HN1 Antibody [NBP2-32492] - Staining of cerebellum.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

HN1 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: MTTTTTFKGVDPNSRNSSRVLRPPGGGSNFSLGFDEPTEQPVRKNKMASNIFGTPEENQASWAKS
Specificity of human HN1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (95%), Rat (97%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
HN1 Lysate (NBP2-66064)
Control Peptide
HN1 Protein (NBP2-32492PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HN1 Antibody

  • Androgen-regulated protein 2
  • ARM2hematological and neurological expressed 1 protein
  • hematological and neurological expressed 1
  • HN1A
  • OPMRX60


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IP, Neut
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC-P, S-ELISA
Species: Hu, Pm
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready, KO
Species: Rt
Applications: WB, Flow, IHC, Block, CyTOF-ready
Species: Hu, Mu, Rt, Bv, Ca
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Ec, NA
Applications: WB, ELISA, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HN1 Antibody (NBP2-32492) (0)

There are no publications for HN1 Antibody (NBP2-32492).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HN1 Antibody (NBP2-32492) (0)

There are no reviews for HN1 Antibody (NBP2-32492). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HN1 Antibody (NBP2-32492) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional HN1 Products

Bioinformatics Tool for HN1 Antibody (NBP2-32492)

Discover related pathways, diseases and genes to HN1 Antibody (NBP2-32492). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HN1 Antibody (NBP2-32492)

Discover more about diseases related to HN1 Antibody (NBP2-32492).

Pathways for HN1 Antibody (NBP2-32492)

View related products by pathway.

PTMs for HN1 Antibody (NBP2-32492)

Learn more about PTMs related to HN1 Antibody (NBP2-32492).

Research Areas for HN1 Antibody (NBP2-32492)

Find related products by research area.

Blogs on HN1

There are no specific blogs for HN1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HN1 Antibody and receive a gift card or discount.


Gene Symbol HN1