E2F3 Antibody - BSA Free

Western Blot: E2F3 Antibody [NBP1-80295] - Host: Mouse. Target Name: E2F3. Sample Tissue: Mouse Small Intestine. Antibody Dilution: 1ug/ml

Western Blot: E2F3 Antibody [NBP1-80295] - Human Thymus lysate, concentration 0.2-1 ug/ml.

Western Blot: E2F3 Antibody [NBP1-80295] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml

Western Blot: E2F3 Antibody [NBP1-80295] - Host: Rabbit. Target Name: E2F3. Sample Tissue: Human Lung Tumor. Antibody Dilution: 1ug/ml

Western Blot: E2F3 Antibody [NBP1-80295] - Host: Rabbit. Target Name: E2F3. Sample Tissue: Human OVCAR-3 Whole Cell. Antibody Dilution: 1ug/ml

Western Blot: Rabbit Polyclonal E2F3 Antibody [NBP1-80295] - E2F3 detection in mouse cortex sample. 1:2000 dilution at 4 degrees overnight to detect endogenous E2F3 from mouse cortex samples (10 ug). Image from a verified customer review.

• Reactivity: Hu, Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

E2F3 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptide directed towards the C terminal of human E2F3. Peptide sequence LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: E2F3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 37 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for E2F3 Antibody - BSA Free

• DKFZp686C18211
• E2F transcription factor 3
• E2F-3
• KIAA0075
• MGC104598
• transcription factor E2F3

Background

E2F3 is encoded by this gene is a member of the E2F family of transcription factors. The E2F family plays a crucial role in the control of cell cycle and action of tumor suppressor proteins and is also a target of the transforming proteins of small DNA tumor viruses. The E2F proteins contain several evolutionally conserved domains found in most members of the family. These domains include a DNA binding domain, a dimerization domain which determines interaction with the differentiation regulated transcription factor proteins (DP), a transactivation domain enriched in acidic amino acids, and a tumor suppressor protein association domain which is embedded within the transactivation domain. This protein and another 2 members, E2F1 and E2F2, have an additional cyclin binding domain. This protein binds specifically to retinoblastoma protein pRB in a cell-cycle dependent manner.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for E2F3 Antibody (NBP1-80295)(1)

Publication using NBP1-80295

• Koehrer,K et al. The German cDNA Consortium. 2004-01-01

Bioinformatics

• Gene Symbol: E2F3
• Entrez:
  • 1871(Human)
• Uniprot:
  • CAH18140(Human)