E2F3 Antibody

Images

 
Western Blot: E2F3 Antibody [NBP1-80295] - Host: Mouse. Target Name: E2F3. Sample Tissue: Mouse Small Intestine. Antibody Dilution: 1ug/ml
Western Blot: E2F3 Antibody [NBP1-80295] - Human Thymus lysate, concentration 0.2-1 ug/ml.
Western Blot: E2F3 Antibody [NBP1-80295] - Sample Tissue: Human Ovary Tumor Antibody Dilution: 1.0 ug/ml
Western Blot: E2F3 Antibody [NBP1-80295] - Host: Rabbit. Target Name: E2F3. Sample Tissue: Human Lung Tumor. Antibody Dilution: 1ug/ml
Western Blot: E2F3 Antibody [NBP1-80295] - Host: Rabbit. Target Name: E2F3. Sample Tissue: Human OVCAR-3 Whole Cell. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

E2F3 Antibody Summary

Immunogen
Synthetic peptide directed towards the C terminal of human E2F3. Peptide sequence LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
E2F3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against E2F3 and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP1-80295.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for E2F3 Antibody

  • DKFZp686C18211
  • E2F transcription factor 3
  • E2F-3
  • KIAA0075
  • MGC104598
  • transcription factor E2F3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67899
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
AF5119
Species: Hu
Applications: WB
NBP1-21374
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-20127
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-26616
Species: Hu
Applications: WB, IP
NBP2-82955
Species: Hu
Applications: WB
NBP2-33735
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P, KD
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-00776
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB600-335
Species: All-NA
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-92787
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-32840
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC

Publications for E2F3 Antibody (NBP1-80295)(1)


Showing Publication 1 - 1 of 1.
Publication using NBP1-80295 Applications Species
Koehrer,K et al. The German cDNA Consortium. 2004

Reviews for E2F3 Antibody (NBP1-80295) (0)

There are no reviews for E2F3 Antibody (NBP1-80295). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for E2F3 Antibody (NBP1-80295) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional E2F3 Products

Bioinformatics Tool for E2F3 Antibody (NBP1-80295)

Discover related pathways, diseases and genes to E2F3 Antibody (NBP1-80295). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for E2F3 Antibody (NBP1-80295)

Discover more about diseases related to E2F3 Antibody (NBP1-80295).
 

Pathways for E2F3 Antibody (NBP1-80295)

View related products by pathway.

PTMs for E2F3 Antibody (NBP1-80295)

Learn more about PTMs related to E2F3 Antibody (NBP1-80295).
 

Research Areas for E2F3 Antibody (NBP1-80295)

Find related products by research area.

Blogs on E2F3

There are no specific blogs for E2F3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our E2F3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol E2F3
Entrez
Uniprot