Kininogen Antibody (4A1)

Immunoprecipitation: HMW Kininogen Antibody (4A1) [H00003827-M02] - Analysis of KNG1 transfected lysate using anti-KNG1 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with KNG1 MaxPab rabbit polyclonal antibody.

Sandwich ELISA: HMW Kininogen Antibody (4A1) [H00003827-M02] - Detection limit for recombinant GST tagged KNG1 is 1 ng/ml as a capture antibody.

Product Discontinued

Kininogen Antibody (4A1) Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: Kininogen (NP_000884.1, 322 a.a. ~ 427 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VARETTCSKESNEELTESCETKKLGQSLDCNAEVYVVPWEKKIYPTVNCQPLGMISLMKRPPGFSPFRSSRIGEIKEETTSHLRSCEYKGRPPKAGAEPASEREVS
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: KNG1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunoprecipitation
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Kininogen Antibody (4A1)

• alpha 2-thiol Proteinase Inhibitor
• BDK
• BDK;BK;HAE6;HK;HMWK;Kininogen-1;KNG;KNG1
• Kininogen
• KNG1

Background

High molecular weight kininogen (HMWK) plays an important role in assembly of the plasma kallikrein (see MIM 147910)-kinin system. The KNG1 gene generates both HMWK and low molecular weight kininogen (LMWK) through alternative splicing. Both HMWK and LMWK contain an identical heavy chain consisting of protein domains 1, 2, and 3. However, HMWK contains a 56-kD light chain that consists of domains 5 and 6H, whereas LMWK contains a unique 4-kD light chain that consists of domain 5L. In both proteins, the heavy and light chains are linked by domain 4, which contains the bradykinin (BK) nonapeptide. BK, which is released by plasma kallikrein, is a potent inflammatory mediator that causes vasodilation and enhanced capillary permeability, induces pain, and stimulates production of nitric oxide and prostacyclin (see MIM 601699) from endothelial cells. During vascular damage, BK stimulates smooth muscle proliferation and intimal hypertrophy. Release of BK from HMWK generates a 2-chain HMWK, termed HMWKa, containing the heavy and light chains joined by a disulfide bond (Merkulov et al., 2008 [PubMed 18000168]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KNG1
• Entrez:
  • 3827(Human)
• Uniprot:
  • NP_000884(Human)