HMGN2 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit HMGN2 Antibody - BSA Free (NBP2-84069) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the N-terminal region of HMGN2. Peptide sequence: MPKRKAEGDAKGDKTKVKDEPQRRSARLSAKPAPPKPEPKPKKAPAKKGE The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
HMGN2 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for HMGN2 Antibody - BSA Free
Background
HMG17 (high mobility group transcription factor 17) is an 18 kD high mobility group chromosomal protein. This nuclear protein is common to all eukaryotes and is developmentally regulated. HMG17 binds DNA in a non-sequence specific manner and interacts with nucleosomes to modulate chromatin structure. HMG17 regulates the gene expression of p53, Hox transcription factors, and steroid hormone receptors (increases DNA binding affinity). Phosphorylation of HMG17 may interfere with nuclear localization and favor release from nuclei. HMG17 is upregulated by wild-type p53 and increases during embryogenesis and is downregulated during differentiation and development. This protein is modified by phosphorylation and acetylation. HMG17 interacts with nucleosomes and probably forms multi-unit complexes with unrelated proteins. The Poly6081 antibody recognizes human and mouse HMG17 and has been shown to be useful for Western blotting.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Hu, Po, Pm, Rb
Applications: WB
Species: Bv, Ca, Hu, Mu, Rb, Rt, Sh
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC, IHC-P, Single-Cell Western, WB
Species: Hu, Mu, Rt
Applications: ChIP, ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Bv, Eq, Hu, Mu
Applications: Flow, ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, IP, KD, WB
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: BA
Species: Mu
Applications: WB
Publications for HMGN2 Antibody (NBP2-84069) (0)
There are no publications for HMGN2 Antibody (NBP2-84069).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for HMGN2 Antibody (NBP2-84069) (0)
There are no reviews for HMGN2 Antibody (NBP2-84069).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for HMGN2 Antibody (NBP2-84069) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional HMGN2 Products
Blogs on HMGN2