HMGN1/HMG14 Antibody - BSA Free

Western Blot: HMGN1/HMG14 Antibody [NBP3-02946] - Analysis of extracts of various cell lines, using HMGN1/HMG14 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection:Basic ECL Kit

Immunocytochemistry/Immunofluorescence: HMGN1/HMG14 Antibody [NBP3-02946] - Analysis of HeLa cells using HMGN1/HMG14 antibody at dilution of 1:100. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HMGN1/HMG14 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HMGN1/HMG14 Antibody - BSA Free (NBP3-02946) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGN1/HMG14 (NP_004956.5). MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HMGN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:100
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 10 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HMGN1/HMG14 Antibody - BSA Free

• FLJ31471
• High mobility group nucleosome-binding domain-containing protein 1
• high-mobility group (nonhistone chromosomal) protein 14
• high-mobility group nucleosome binding 1
• high-mobility group nucleosome binding domain 1
• HMG14
• HMG14FLJ27265
• HMGN1
• MGC104230
• MGC117425
• non-histone chromosomal protein HMG-14
• nonhistone chromosomal protein HMG-14

Background

HMGNs are proteins that bind chromatin effectively reducing the compaction of the chromatin fiber and enhancing access to DNA regulatory sequences. Members of this family have a conserved chromatin binding domain which is phosphorylated during mitosis. The sequence immunized is conserved in several species. As such, this reagent is designed as a universal reagent for the detection of all phosphorylated HMGN proteins. The High Mobility Group (HMG) proteins were originally isolated from mammalian cells and were named according to their electrophoretic mobility in polyacrylamide gels. HMGs were arbitrarily classed as a specific type of nonhistone proteins based on the observation that they are ubiquitous to mammalian cells, that they share certain physical properties, and that they are associated with isolated chromatin. HMG proteins and are now subdivided into 3 families: the HMGB (formerly HMG-1/-2) family, the HMGN (formerly HMG-14/-17) family, and the HMGA (formerly HMG-I/Y/C) family. Each HMG family has a characteristic functional sequence motif. The functional motif of the HMGB family is called the "HMG-box;" that of the HMGN family, the "nucleosomal binding domain;" and that of the HMGA family, the "AT-hook." The functional motifs characteristic of these canonical HMGs are widespread among nuclear proteins in a variety of organisms. Proteins containing any of these functional motifs embedded in their sequence are known as "HMG motif proteins."

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HMGN1