HMGCS2 Antibody (1E9) - Azide and BSA Free

Western Blot: HMGCS2 Antibody (1E9) [H00003158-M06] - Analysis of HMGCS2 expression in transfected 293T cell line by HMGCS2 monoclonal antibody (M06), clone 1E9. Lane 1: HMGCS2 transfected lysatE (56.6 KDa). Lane 2: Non-transfected lysate.

Sandwich ELISA: HMGCS2 Antibody (1E9) [H00003158-M06] - Detection limit for recombinant GST tagged HMGCS2 is approximately 1ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1E9
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

HMGCS2 Antibody (1E9) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: HMGCS2 (NP_005509.1, 424 a.a. ~ 508 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVSQDAAPGSPLDKLVSSTSDLPKRLASRKCVSPEEFTEIMNQREQFYHKVNFSPPGDTNSLFPGTWYLERVDEQHRRKYARRPV
• Specificity: HMGCS2 - 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial) (1E9)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HMGCS2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactivity against recombinant protein for WB. It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HMGCS2 Antibody (1E9) - Azide and BSA Free

• 3-hydroxy-3-methylglutaryl coenzyme A synthase
• 3-hydroxy-3-methylglutaryl-CoA synthase 2 (mitochondrial)
• 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 2 (mitochondrial)
• EC 2.3.3.10
• HMG-CoA synthase
• hydroxymethylglutaryl-CoA synthase, mitochondrial
• mitochondrial 3-hydroxy-3-methylglutaryl-CoA synthase

Background

HMGCS2 is an enzyme that condenses acetyl CoA with acetoacetyl CoA to form HMG CoA, which is the substrate for HMG CoA reductase. Together with HMG CoA lyase, it is responsible for ketone body biosynthesis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HMGCS2 Antibody (H00003158-M06)(1)

Publication using H00003158-M06

• isac B, Marcos-Alcalde I, Hernandez-Marcos M et al. Human Mitochondrial HMG-CoA Synthase Deficiency: Role of Enzyme Dimerization Surface and Characterization of Three New Patients. Int J Mol Sci 2018-03-28 [PMID: 29597274]

Bioinformatics

• Gene Symbol: HMGCS2
• Entrez:
  • 3158(Human)
• Uniprot:
  • NP_005509(Human)