HMGCS1 Antibody

Images

 
Western Blot: HMGCS1 Antibody [NBP2-14094] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-270
Immunohistochemistry-Paraffin: HMGCS1 Antibody [NBP2-14094] - Staining of human colon shows strong cytoplasmic positivity with a granular pattern in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HMGCS1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TLYSLKVTQDATPGSALDKITASLCDLKSRLDSRTGVAPDVFAENMKLRE DTHHLVNYIPQGSIDSLFEGTWY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (96%), Rat (96%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HMGCS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HMGCS1 Protein (NBP2-14094PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HMGCS1 Antibody

  • 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) synthase
  • 3-hydroxy-3-methylglutaryl coenzyme A synthase
  • 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble)
  • 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble)
  • EC 2.3.3.10
  • HMG-CoA synthase
  • HMGCS
  • hydroxymethylglutaryl-CoA synthase, cytoplasmic
  • MGC90332

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-33908
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-78159
Species: Hu, Rt, Po, Bv
Applications: WB, EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, RIA
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP2-16463
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-582
Species: Hu, Mu, Rt, Ca, Ch, SyHa, Ha
Applications: WB, Simple Western
NBP1-89285
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB9120
Species: Hu
Applications: ICC
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-54446
Species: Hu, Ch
Applications: WB, ELISA, GS, ICC/IF, IP
NBP2-02588
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01170
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-42632
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
H00001376-B01P
Species: Hu
Applications: WB
NBP1-83368
Species: Hu
Applications: WB, IHC, IHC-P
AF8516
Species: Hu
Applications: WB, Simple Western, IP, ICC

Publications for HMGCS1 Antibody (NBP2-14094) (0)

There are no publications for HMGCS1 Antibody (NBP2-14094).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HMGCS1 Antibody (NBP2-14094) (0)

There are no reviews for HMGCS1 Antibody (NBP2-14094). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HMGCS1 Antibody (NBP2-14094) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HMGCS1 Products

Bioinformatics Tool for HMGCS1 Antibody (NBP2-14094)

Discover related pathways, diseases and genes to HMGCS1 Antibody (NBP2-14094). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMGCS1 Antibody (NBP2-14094)

Discover more about diseases related to HMGCS1 Antibody (NBP2-14094).
 

Pathways for HMGCS1 Antibody (NBP2-14094)

View related products by pathway.

PTMs for HMGCS1 Antibody (NBP2-14094)

Learn more about PTMs related to HMGCS1 Antibody (NBP2-14094).

Blogs on HMGCS1

There are no specific blogs for HMGCS1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HMGCS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HMGCS1