Home » HMGCS1 » HMGCS1 Antibodies » HMGCS1 Antibody

HMGCS1 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: HMGCS1 Antibody [NBP1-54623] - Titration: 1 ug/ml Positive Control: 293T cells lysate.
Western Blot: HMGCS1 Antibody [NBP1-54623] - Titration: 1 ug/ml Positive Control: 293T cells lysate.
Immunohistochemistry-Paraffin: HMGCS1 Antibody [NBP1-54623] - Human Skeletal Muscle, 5.0ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

HMGCS1 Antibody Summary

Immunogen
Synthetic peptides corresponding to HMGCS1(3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble)) The peptide sequence was selected from the middle region of HMGCS1. Peptide sequence KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HMGCS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against HMGCS1 and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HMGCS1 Antibody

  • 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) synthase
  • 3-hydroxy-3-methylglutaryl coenzyme A synthase
  • 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble)
  • 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble)
  • EC 2.3.3.10
  • HMG-CoA synthase
  • HMGCS
  • hydroxymethylglutaryl-CoA synthase, cytoplasmic
  • MGC90332

Background

This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

HMG-CoA
Reductase/HMGCR Antib ...
NBP2-66888
Simple Western: HMG-CoA Reductase/HMGCR Antibody (JF0981) [NBP2-66888] - SVG-A whole cell lysate. Antibody at 1:25 dilution. Image submitted by a verified customer review.
Western Blot: HMG-CoA Reductase/HMGCR Antibody (JF0981) [NBP2-66888] - Analysis of HMGCR on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (ET1702-41, 1/500) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody (HA1001) at 1:5,000 dilution was used for 1 hour at room temperature.Positive control: Lane 1: Hela cell lysateLane 2: THP-1 cell lysate
(1 Review)
(3 Publications)
Species: Hu, Mu, Rt
Applications: IHC-P, IP, Simple Western, WB
HMGCS2 Antibody
NBP2-33908
Immunocytochemistry/Immunofluorescence: HMGCS2 Antibody [NBP2-33908] - Staining of human cell line RT4 shows localization to mitochondria. Antibody staining is shown in green.
Western Blot: HMGCS2 Antibody [NBP2-33908] - Analysis using Anti-HMGCS2 antibody NBP2-33908 (A) shows similar pattern to independent antibody NBP2-33907 (B).
Immunohistochemistry-Paraffin: HMGCS2 Antibody [NBP2-33908] - Analysis in human liver and cerebral cortex tissues. Corresponding HMGCS2 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
LDLR Antibody (C7)
NBP1-78159
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Antibody was tested in HepG2 cells with FITC (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry: LDL R Antibody (C7) [NBP1-78159] - Analysis of an FFPE tissue section of human liver using LDL Receptor antibody (clone C7) with HRP-DAB based detection and hematoxylin counterstaining.
Immunocytochemistry/Immunofluorescence: LDL R Antibody (C7) [NBP1-78159] - Image from a customer review on porcine intestinal epithelial cells IPEC-J2.
(1 Review)
(22 Publications)
Species: Bv, Hu, Po, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA, WB
PPAR alpha/NR1C1
Antibody (3B6/PPAR) - ...
NB300-537
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on Jurkat cells with PPAR alpha/NR1C1 Antibody (3B6/PPAR) NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
Western Blot: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - Analysis of 25 ug of Hela (Lane 1), Jurkat (Lane 2), and NIH-3T3 cell lysates (Lane 3) and a molecular weight protein ladder.
Flow Cytometry: PPAR alpha/NR1C1 Antibody (3B6/PPAR) [NB300-537] - An intracellular stain was performed on U-87 cells with PPAR alpha/NR1C1 Antibody [3B6/PPAR] NB300-537AF647 (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeabilized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 647.
(1 Review)
(13 Publications)
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
FDPS Antibody
NBP2-16463
Western Blot: FDPS Antibody [NBP2-16463] - A. 50 ug rat liver lysate/extract 10% SDS-PAGE FDPS antibody dilution: 1:5000 The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Western Blot: FDPS Antibody [NBP2-16463] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with FDPS antibody [N1C3] diluted at 1:3000. The HRP-conjugated anti-rabbit IgG antibody (NBP2-19301) was used to detect the primary antibody.
Immunocytochemistry/Immunofluorescence: FDPS Antibody [NBP2-16463] - HeLa cells were fixed in ice-cold MeOH for 5 min. Green: FDPS protein stained by FDPS antibody [N1C3] diluted at 1:500. Blue: Hoechst 33342 staining. Scale bar = 10 um.
(1 Review)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
SREBP1 Antibody
(2A4) - BSA Free
NB600-582
Western Blot: SREBP1 Antibody (2A4) [NB600-582] - Hepatic SREBP1c and SREBP2 protein abundance in C57BL/6 mice assigned to a high-fat (HF) or a high-fat/exercise (HF + EX) group for 8 weeks. Cytosolic and nuclear SREBP1c abundance. Image collected and cropped by CiteAb from the following publication (http://www.hindawi.com/journals/jl/2013/908048/), licensed under a CC-BY licence.
Knockout Validated: SREBP1 Antibody (2A4) [NB600-582] - KO and OE of SREBP1 influenced lipid metabolism in Bel-7402 cells. The protein level of lipid-associated genes in SREBP1-KO, SREBP1-OE, and WT Bel-7402 cells. Data were expressed as mean -/+ standard error of the mean. *P < 0.05, **P < 0.01, and ***P < 0.001 vs. WT group, respectively.
Simple Western: SREBP1 Antibody (2A4) [NB600-582] - Lane view shows a specific band for SREBP1 in 1.0 mg/ml of HeLa lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.
(47 Publications)
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
ACAT1 Antibody
NBP1-89284
Western Blot: ACAT1 Antibody [NBP1-89284] - ACAT1 porcine cerebral cortex. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: ACAT1 Antibody [NBP1-89284] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: ACAT1 Antibody [NBP1-89284] - Staining of human cerebellum, kidney, liver and testis using Anti-ACAT1 antibody NBP1-89284 (A) shows similar protein distribution across tissues to independent antibody NBP1-89285 (B).
(1 Review)
(5 Publications)
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
PPAR gamma/NR1C3
Antibody - BSA Free
NBP2-22106
Western Blot: PPAR gamma/NR1C3 Antibody [NBP2-22106] - Total protein from 3T3-L1 mouse embryonic fibroblast adipose-like cell line, separated by 4-12% SDS-PAGE, transferred to nitrocellulose membrane and blocked in 5% non-fat milk for 1h at room temperature. The membrane was probed with anti-PPAR gamma 1:800 in non-fat milk. Lane 2-7 increasing protein concentration, undifferentiated adipocytes. Lane 8-13 increasing protein concentration, differentiated adipocytes. This image was submitted via customer review.
Immunohistochemistry-Paraffin: PPAR gamma Antibody [NBP2-22106] - IHC analysis of PPAR gamma in mouse liver.
Western Blot: PPAR gamma Antibody [NBP2-22106] - Western blot analysis of PPAR gamma in 1. human adipose and 2. human adrenal lysate.
(2 Reviews)
(8 Publications)
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
Fatty Acid
Synthase/FASN Antibod
NB400-114
Immunocytochemistry/Immunofluorescence: Fatty Acid Synthase/FASN Antibody [NB400-114] - Fatty acid synthesis requirement for CHIKV life cycle. Confocal section of CHIKV replicon-infected HeLa cells labelled for FASN, dsRNA and 4,6-diamidino-2-phenylindole (DAPI; blue). Scale bar, 10 um. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/doifinder/10.1038/ncomms11320), licensed under a CC-BY licence.
Western Blot: Fatty Acid Synthase/FASN Antibody [NB400-114] - Analysis of Fatty Acid Synthase, using NB400-114. Samples: 50 ug of total mouse liver lysate.
Immunohistochemistry-Paraffin: Fatty Acid Synthase/FASN Antibody [NB400-114] - Immunohistochemical localization of FAS in chicken hypothalmus. Paraffin sections were obtained from 3-wk-old broiler chickens.
(2 Reviews)
(24 Publications)
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
CYP7A1 Antibody
(946902) [Unconjugate
MAB9120
CYP7A1 was detected in immersion fixed human hepatocytes induced with dexamethasone for 48 hours using Mouse Anti-Human CYP7A1 Polyclonal Antibody (Catalog # MAB9120) at 10 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Mouse IgG Secondary Antibody (red; Catalog # NL007) and counterstained with DAPI (green). Specific staining was localized to endoplasmic reticula and cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Species: Hu
Applications: ICC
SQLE Antibody
NBP2-32005
Western Blot: SQLE Antibody [NBP2-32005] - Analysis in human cell line MCF-7 and human cell line U-251 MG.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32005] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: SQLE Antibody [NBP2-32005] - Staining of human skeletal muscle shows no positivity in myocytes as expected.
Species: Hu
Applications: IHC, IHC-P, WB
SREBP2 Antibody
(1D2) - BSA Free
NBP1-54446
Western Blot: SREBP2 Antibody (1D2) [NBP1-54446] - Lane1: HEp-2 cells. Lane 2: MCF-7 cells. Lane 3: LNCaP cells. Lane 4: HT1080 cells. Lane 5: ZR75-1 cells.
Immunocytochemistry/Immunofluorescence: SREBP2 Antibody (1D2) [NBP1-54446] - SREBP2 (1D2) antibody was tested in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
(17 Publications)
Species: Ch, Hu
Applications: ELISA, GS, ICC/IF, IP, WB
ACAT2 Antibody
(OTI3E2)
NBP2-02588
Flow Cytometry: ACAT2 Antibody (3E2) [NBP2-02588] - Analysis of Jurkat cells, using anti-ACAT2 antibody, (Red), compared to a nonspecific negative control antibody (Blue).
Flow Cytometry: ACAT2 Antibody (3E2) [NBP2-02588] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-ACAT2 antibody, and then analyzed by flow cytometry.
Western Blot: ACAT2 Antibody (3E2) [NBP2-02588] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY ACAT2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-ACAT2.
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
FDFT1 Antibody
(OTI2F10)
NBP2-01170
Western Blot: FDFT1 Antibody (2F10) [NBP2-01170] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY FDFT1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-FDFT1.
Immunohistochemistry-Paraffin: FDFT1 Antibody (2F10) [NBP2-01170] - Staining of paraffin-embedded Adenocarcinoma of Human endometrium tissue using anti-FDFT1 mouse monoclonal antibody.
Immunohistochemistry-Paraffin: FDFT1 Antibody (2F10) [NBP2-01170] - Staining of paraffin-embedded Carcinoma of Human thyroid tissue using anti-FDFT1 mouse monoclonal antibody.
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
CNBP Antibody
(38F10) - BSA Free
NBP2-42632
Flow Cytometry: CNBP Antibody (38F10) [NBP2-42632] - Analysis of CNBP in MCF7 cell line, stainingat 2-5ug for 1x106cells (red line). The secondary antibodyused goat anti-mouse IgG Alexa fluor 488 conjugate. Isotypecontrol antibody was mouse IgG (black line).
Immunocytochemistry/Immunofluorescence: CNBP Antibody (38F10) [NBP2-42632] - Analysis in MCF7 cells line, stained with DAPI (Blue) for nucleus staining and monoclonal anti-human CNBP antibody (1:100) with goat anti-mouse IgG-Alexa fluor488 conjugate (Green).
Western Blot: CNBP Antibody (38F10) [NBP2-42632] - Analysis in Jurkat lysates.
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
CPT2 Antibody
NBP1-85471
Immunocytochemistry/Immunofluorescence: CPT2 Antibody [NBP1-85471] - Staining of human cell line A-431 shows localization to nucleoplasm, nucleoli & mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: CPT2 Antibody [NBP1-85471] - Staining of human duodenum shows moderate cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: CPT2 Antibody [NBP1-85471] - Staining of human kidney shows moderate to strong cytoplasmic positivity in cells in tubules.
(1 Publication)
Species: Hu
Applications: ICC/IF, IHC, IHC-P
GGPS1 Antibody
NBP1-83368
Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining of human testis shows high expression.
Immunohistochemistry-Paraffin: GGPS1 Antibody [NBP1-83368] - Staining in human testis and pancreas tissues using anti-GGPS1 antibody. Corresponding GGPS1 RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P, WB
MVK Antibody
[Unconjugated]
AF8516
MVK was detected in immersion fixed A431 human epithelial carcinoma cell line using Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) at 2 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Rabbit IgG Secondary Antibody (red; Catalog # NL004) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
Western blot shows lysates of HepG2 human hepatocellular carcinoma cell line, A431 human epithelial carcinoma cell line, and HEK001 human epidermal keratinocyte cell line. PVDF membrane was probed with 0.1 µg/mL of Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for MVK at approximately 42 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
MVK was immunoprecipitated from 400 µg of HepG2 human hepatocellular carcinoma cell line and A431 human epithelial carcinoma cell line lysates using 4 µg of Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) coated on 4 wells of a 96 well plate (Corning Costar EIA/RIA). HepG2 lysates, A431 lysates, Rabbit IgG control buffer, or recombinant human MVK were added to the wells and incubated for 2 hours at room temperature. Immunoprecipitated MVK was detected by Western blot under reducing conditions using 0.1 µg/mL Rabbit Anti-Human MVK Antigen Affinity-purified Polyclonal Antibody (Catalog # AF8516) and Immunoblot Buffer Group 1. View our recommended buffer recipes for Immunoprecipitation.
Species: Hu
Applications: ICC, IP, Simple Western, WB

Publications for HMGCS1 Antibody (NBP1-54623) (0)

There are no publications for HMGCS1 Antibody (NBP1-54623).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HMGCS1 Antibody (NBP1-54623) (0)

There are no reviews for HMGCS1 Antibody (NBP1-54623). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HMGCS1 Antibody (NBP1-54623) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HMGCS1 Products

Bioinformatics Tool for HMGCS1 Antibody (NBP1-54623)

Discover related pathways, diseases and genes to HMGCS1 Antibody (NBP1-54623). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMGCS1 Antibody (NBP1-54623)

Discover more about diseases related to HMGCS1 Antibody (NBP1-54623).
 

Pathways for HMGCS1 Antibody (NBP1-54623)

View related products by pathway.

PTMs for HMGCS1 Antibody (NBP1-54623)

Learn more about PTMs related to HMGCS1 Antibody (NBP1-54623).
 

Research Areas for HMGCS1 Antibody (NBP1-54623)

Find related products by research area.

Blogs on HMGCS1

There are no specific blogs for HMGCS1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HMGCS1 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol HMGCS1
Uniprot