HMGCS1 Antibody

Images

 
Western Blot: HMGCS1 Antibody [NBP1-54623] - Titration: 1 ug/ml Positive Control: 293T cells lysate.
Immunohistochemistry-Paraffin: HMGCS1 Antibody [NBP1-54623] - Human Skeletal Muscle, 5.0ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HMGCS1 Antibody Summary

Immunogen
Synthetic peptides corresponding to HMGCS1(3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble)) The peptide sequence was selected from the middle region of HMGCS1. Peptide sequence KDFTLNDFGFMIFHSPYCKLVQKSLARMLLNDFLNDQNRDKNSIYSGLEA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HMGCS1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against HMGCS1 and was validated on Western blot.
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HMGCS1 Antibody

  • 3-hydroxy-3-methylglutaryl coenzyme A (HMG-CoA) synthase
  • 3-hydroxy-3-methylglutaryl coenzyme A synthase
  • 3-hydroxy-3-methylglutaryl-CoA synthase 1 (soluble)
  • 3-hydroxy-3-methylglutaryl-Coenzyme A synthase 1 (soluble)
  • EC 2.3.3.10
  • HMG-CoA synthase
  • HMGCS
  • hydroxymethylglutaryl-CoA synthase, cytoplasmic
  • MGC90332

Background

This enzyme condenses acetyl-CoA with acetoacetyl-CoA to form HMG-CoA, which is the substrate for HMG-CoA reductase.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-66888
Species: Hu, Mu, Rt
Applications: IHC-P, IP, Simple Western, WB
NBP2-33908
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-78159
Species: Bv, Hu, Po, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, PLA, RIA, WB
NB300-537
Species: Bv, Hu, Mu, Rb, Rt
Applications: ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-16463
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
NBP1-89284
Species: Hu, Po
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-22106
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, IP, WB
NB400-114
Species: Ch, Fe, Ha, Hu, Mu, Pl, Po, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KD, WB
MAB9120
Species: Hu
Applications: ICC
NBP2-32005
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-54446
Species: Ch, Hu
Applications: ELISA, GS, ICC/IF, IP, WB
NBP2-02588
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-01170
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-42632
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
NBP1-85471
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-83368
Species: Hu
Applications: IHC, IHC-P, WB
AF8516
Species: Hu
Applications: ICC, IP, Simple Western, WB

Publications for HMGCS1 Antibody (NBP1-54623) (0)

There are no publications for HMGCS1 Antibody (NBP1-54623).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HMGCS1 Antibody (NBP1-54623) (0)

There are no reviews for HMGCS1 Antibody (NBP1-54623). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HMGCS1 Antibody (NBP1-54623) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HMGCS1 Products

Bioinformatics Tool for HMGCS1 Antibody (NBP1-54623)

Discover related pathways, diseases and genes to HMGCS1 Antibody (NBP1-54623). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMGCS1 Antibody (NBP1-54623)

Discover more about diseases related to HMGCS1 Antibody (NBP1-54623).
 

Pathways for HMGCS1 Antibody (NBP1-54623)

View related products by pathway.

PTMs for HMGCS1 Antibody (NBP1-54623)

Learn more about PTMs related to HMGCS1 Antibody (NBP1-54623).
 

Research Areas for HMGCS1 Antibody (NBP1-54623)

Find related products by research area.

Blogs on HMGCS1

There are no specific blogs for HMGCS1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HMGCS1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HMGCS1
Uniprot