HLA F Antibody

Images

 
Western Blot: HLA F Antibody [NBP1-59537] - 721_B cell lysate, concentration 0.2-1 ug/ml.
Immunocytochemistry/ Immunofluorescence: HLA F Antibody [NBP1-59537] - Formalin Fixed Paraffin Embedded Tissue: Human Lung Tissue Observed Staining: Membrane and cytoplasmic in alveolar type I cells

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

HLA F Antibody Summary

Immunogen
Synthetic peptides corresponding to HLA-F(major histocompatibility complex, class I, F) The peptide sequence was selected from the N terminal of HLA-F. Peptide sequence EAGSHTLQGMNGCDMGPDGRLLRGYHQHAYDGKDYISLNEDLRSWTAADT. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HLA-F
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against HLA-F and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for HLA F Antibody

  • alpha chain F
  • CDA12
  • HLA class I molecule
  • HLA F antigen
  • HLA-5.4
  • HLAF
  • HLA-F
  • HLAFHLA-CDA12
  • Leukocyte antigen F
  • major histocompatibility complex, class I, F
  • MHC class I antigen F
  • MHC class Ib antigen

Background

HLA-F belongs to the HLA class I heavy chain paralogues. It is a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation. This gene belongs to the HLA class I heavy chain paralogues. It encodes a non-classical heavy chain that forms a heterodimer with a beta-2 microglobulin light chain, with the heavy chain anchored in the membrane. Unlike most other HLA heavy chains, this molecule is localized in the endoplasmic reticulum and Golgi apparatus, with a small amount present at the cell surface in some cell types. It contains a divergent peptide-binding groove, and is thought to bind a restricted subset of peptides for immune presentation. This gene exhibits few polymorphisms. Multiple transcript variants encoding different isoforms have been found for this gene. These variants lack a coding exon found in transcripts from other HLA paralogues due to an altered splice acceptor site, resulting in a shorter cytoplasmic domain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB120-6405
Species: Rt
Applications: B/N, CyTOF-ready, EM, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-43123
Species: Hu
Applications: B/N, CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr
NB100-64775
Species: Pm, Bv, Hu, Mu, Pm
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P (-), IP
NBP2-61871
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
H00003126-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP2-50419
Species: Hu
Applications: CyTOF-ready, Flow, IP
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NBP1-49045
Species: Mu, Rt
Applications: Cell Depl, CyTOF-ready, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, InhibTFunc
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
NBP2-01346
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB24251
Species: Hu
Applications: CyTOF-ready, Flow, WB
H00003077-M01
Species: Hu
Applications: ELISA, ICC/IF, WB
MAB2078
Species: Hu
Applications: CyTOF-ready, Flow, Neut, WB
NBP3-16731
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
H00006890-M04
Species: Hu
Applications: ELISA, Flow, ICC/IF, WB
202-IL
Species: Hu
Applications: BA
NBP1-90286
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB

Publications for HLA F Antibody (NBP1-59537) (0)

There are no publications for HLA F Antibody (NBP1-59537).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA F Antibody (NBP1-59537) (0)

There are no reviews for HLA F Antibody (NBP1-59537). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HLA F Antibody (NBP1-59537) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HLA F Products

Array NBP1-59537

Bioinformatics Tool for HLA F Antibody (NBP1-59537)

Discover related pathways, diseases and genes to HLA F Antibody (NBP1-59537). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA F Antibody (NBP1-59537)

Discover more about diseases related to HLA F Antibody (NBP1-59537).
 

Pathways for HLA F Antibody (NBP1-59537)

View related products by pathway.

PTMs for HLA F Antibody (NBP1-59537)

Learn more about PTMs related to HLA F Antibody (NBP1-59537).
 

Research Areas for HLA F Antibody (NBP1-59537)

Find related products by research area.

Blogs on HLA F

There are no specific blogs for HLA F, but you can read our latest blog posts.
Download our IHC Handbook

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA F Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-F
Uniprot