HLA DRB4 Antibody - BSA Free

Images

 
Western Blot: HLA DRB4 Antibody [NBP3-03662] - Analysis of extracts of various cell lines, using HLA DRB4 antibody at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. ...read more

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

HLA DRB4 Antibody - BSA Free Summary

Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 30-227 of human HLA DRB4 (NP_068818.4). GDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSK
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HLA-DRB4
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:1000-1:4000
Theoretical MW
29 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS with 50% glycerol, pH7.3.
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for HLA DRB4 Antibody - BSA Free

  • class II histocompatibility antigen HLA DR alpha, beta1-0307
  • DR12
  • DR-12
  • DR13
  • DR-13
  • DR14
  • DR-14
  • DR4
  • DR-4
  • DRB1 transplantation antigen
  • DRB4
  • HLA class II histocompatibility antigen, DR beta 4 chain
  • HLA class II histocompatibility antigen, DRB1-12 beta chain
  • HLA class II histocompatibility antigen, DRB1-4 beta chain
  • HLA-DR4B
  • human leucocyte antigen DRB4
  • leucocyte antigen DRB1
  • leukocyte antigen
  • major histocompatibility complex, class II, DR beta 1
  • major histocompatibility complex, class II, DR beta 4
  • MHC class I antigen DRB1*12
  • MHC class I antigen DRB1*4
  • MHC class II antigen DRB1*12
  • MHC class II antigen DRB1*13
  • MHC class II antigen DRB1*14
  • MHC class II antigen DRB1*4
  • MHC class II antigen DRB4
  • MHC class II antigen HLA-DRB1
  • MHC class II antigen HLA-DR-beta
  • MHC class II HLA-DR-beta-7
  • MHC class2 antigen
  • MHC HLA DR-beta chain

Background

HLA-DRB4 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogues DRB3, DRB4 and DRB5. The presence of DRB4 is linked with allelic variants of DRB1, otherwise it is omitted. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HLA DRB4 Antibody (NBP3-03662) (0)

There are no publications for HLA DRB4 Antibody (NBP3-03662).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DRB4 Antibody (NBP3-03662) (0)

There are no reviews for HLA DRB4 Antibody (NBP3-03662). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DRB4 Antibody (NBP3-03662) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HLA DRB4 Products

Research Areas for HLA DRB4 Antibody (NBP3-03662)

Find related products by research area.

Blogs on HLA DRB4

There are no specific blogs for HLA DRB4, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA DRB4 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DRB4