DR1 Antibody

Images

 
Western Blot: DR1 Antibody [NBP2-47480] - Analysis in control (vector only transfected HEK293T lysate) and DR1 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunocytochemistry/ Immunofluorescence: DR1 Antibody [NBP2-47480] - Immunofluorescent staining of human cell line PC-3 shows localization to nucleus.
Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480] - Staining of human cerebral cortex.
Immunohistochemistry: DR1 Antibody [NBP2-47480] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.
Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480] - Staining of human liver shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480] - Staining in human testis and liver tissues using anti-DR1 antibody. Corresponding DR1 RNA-seq data are presented for the same ...read more
Independent Antibodies: Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480] - Staining of human cerebral cortex, gallbladder, liver and testis using Anti-DR1 antibody NBP2-47480 (A) shows similar protein ...read more
Immunohistochemistry-Paraffin: DR1 Antibody [NBP2-47480] - Staining of human gallbladder.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

DR1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EVKEVLQECKTVALKRRKASSRLENLGIPEEELLRQQQELFAKARQQQAELAQQEWLQMQQ
Specificity
Specificity of human DR1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control
DR1 Knockout 293T Cell Lysate
Control Peptide
DR1 Protein (NBP2-47480PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for DR1 Antibody

  • Down-regulator of transcription 1
  • down-regulator of transcription 1, TBP-binding (negative cofactor 2)
  • NC2
  • NC2-BETA
  • Negative cofactor 2-beta
  • protein Dr1
  • TATA-binding protein-associated phosphoprotein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NBP3-03661
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-45312
Species: Hu, Pm, Mu(-)
Applications: WB, Flow, IHC, IHC-P, IF
NB100-56618
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-CS
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP2-14093
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-59208
Species: Hu, Mu
Applications: WB, ChIP, CHIP-SEQ, KD
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP2-61871
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-64775
Species: Hu, Mu, Pm, Bv, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP, CyTOF-ready, IHC-P (-)
NBP3-04883
Species: Hu, Mu, Rt
Applications: WB
NBP2-67150
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-53380
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
AF144
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-47480
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for DR1 Antibody (NBP2-47480) (0)

There are no publications for DR1 Antibody (NBP2-47480).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for DR1 Antibody (NBP2-47480) (0)

There are no reviews for DR1 Antibody (NBP2-47480). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for DR1 Antibody (NBP2-47480) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Control Lysate(s)

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional DR1 Products

Bioinformatics Tool for DR1 Antibody (NBP2-47480)

Discover related pathways, diseases and genes to DR1 Antibody (NBP2-47480). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for DR1 Antibody (NBP2-47480)

Discover more about diseases related to DR1 Antibody (NBP2-47480).
 

Pathways for DR1 Antibody (NBP2-47480)

View related products by pathway.

PTMs for DR1 Antibody (NBP2-47480)

Learn more about PTMs related to DR1 Antibody (NBP2-47480).
 

Research Areas for DR1 Antibody (NBP2-47480)

Find related products by research area.

Blogs on DR1

There are no specific blogs for DR1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our DR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DR1