HLA DRB4 Antibody

Images

 
Western Blot: HLA DRB4 Antibody [H00003126-B01P] - Analysis of HLA-DRB4 expression in Jurkat.
Western Blot: HLA DRB4 Antibody [H00003126-B01P] - Analysis of HLA-DRB4 expression in transfected 293T cell line by HLA-DRB4 polyclonal antibody. Lane 1: HLA-DRB4 transfected lysate(29.90 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HLA DRB4 Antibody Summary

Immunogen
HLA-DRB4 (NP_068818.4, 1 a.a. - 266 a.a.) full-length human protein. MVCLKLPGGSCMAALTVTLTVLSSPLALAGDTQPRFLEQAKCECHFLNGTERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSMMSPLTVQWSARSESAQSKMLSGVGGFVLGLLFLGTGLFIYFRNQKGHSGLQPTGLLS
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
HLA-DRB4
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HLA DRB4 Antibody

  • class II histocompatibility antigen HLA DR alpha, beta1-0307
  • DR12
  • DR-12
  • DR13
  • DR-13
  • DR14
  • DR-14
  • DR4
  • DR-4
  • DRB1 transplantation antigen
  • DRB4
  • HLA class II histocompatibility antigen, DR beta 4 chain
  • HLA class II histocompatibility antigen, DRB1-12 beta chain
  • HLA class II histocompatibility antigen, DRB1-4 beta chain
  • HLA-DR4B
  • human leucocyte antigen DRB4
  • leucocyte antigen DRB1
  • leukocyte antigen
  • major histocompatibility complex, class II, DR beta 1
  • major histocompatibility complex, class II, DR beta 4
  • MHC class I antigen DRB1*12
  • MHC class I antigen DRB1*4
  • MHC class II antigen DRB1*12
  • MHC class II antigen DRB1*13
  • MHC class II antigen DRB1*14
  • MHC class II antigen DRB1*4
  • MHC class II antigen DRB4
  • MHC class II antigen HLA-DRB1
  • MHC class II antigen HLA-DR-beta
  • MHC class II HLA-DR-beta-7
  • MHC class2 antigen
  • MHC HLA DR-beta chain

Background

HLA-DRB4 belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DRA) and a beta (DRB) chain, both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. Within the DR molecule the beta chain contains all the polymorphisms specifying the peptide binding specificities. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. DRB1 is expressed at a level five times higher than its paralogues DRB3, DRB4 and DRB5. The presence of DRB4 is linked with allelic variants of DRB1, otherwise it is omitted. There are 4 related pseudogenes: DRB2, DRB6, DRB7, DRB8 and DRB9.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP1-43123
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, CyTOF-ready
NBP2-53380
Species: Hu
Applications: ICC/IF, IHC-P, PAGE
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
AF347
Species: Hu
Applications: WB, IHC, Neut
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-84549
Species: Hu
Applications: WB, IHC, IHC-P
H00001810-B01P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB943
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-14984
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
H00003126-B01P
Species: Hu
Applications: WB

Publications for HLA DRB4 Antibody (H00003126-B01P) (0)

There are no publications for HLA DRB4 Antibody (H00003126-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DRB4 Antibody (H00003126-B01P) (0)

There are no reviews for HLA DRB4 Antibody (H00003126-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DRB4 Antibody (H00003126-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HLA DRB4 Products

Bioinformatics Tool for HLA DRB4 Antibody (H00003126-B01P)

Discover related pathways, diseases and genes to HLA DRB4 Antibody (H00003126-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA DRB4 Antibody (H00003126-B01P)

Discover more about diseases related to HLA DRB4 Antibody (H00003126-B01P).
 

Pathways for HLA DRB4 Antibody (H00003126-B01P)

View related products by pathway.

PTMs for HLA DRB4 Antibody (H00003126-B01P)

Learn more about PTMs related to HLA DRB4 Antibody (H00003126-B01P).
 

Research Areas for HLA DRB4 Antibody (H00003126-B01P)

Find related products by research area.

Blogs on HLA DRB4

There are no specific blogs for HLA DRB4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA DRB4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DRB4
Uniprot