HLA DQA1 Antibody (1A3)

Proximity Ligation Assay: HLA DQA1 Antibody (1A3) [H00003117-M01] - Analysis of protein-protein interactions between CD74 and HLA-DQA1. HeLa cells were stained with anti-CD74 rabbit purified polyclonal 1:1200 and anti-HLA-DQA1 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).

ELISA: HLA DQA1 Antibody (1A3) [H00003117-M01] - Detection limit for recombinant GST tagged HLA-DQA1 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA, PLA, S-ELISA
• Clone: 1A3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

HLA DQA1 Antibody (1A3) Summary

• Immunogen: HLA-DQA1 (NP_002113.2, 24 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEEFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATN
• Specificity: HLA-DQA1 - major histocompatibility complex, class II, DQ alpha 1 (1A3)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: HLA-DQA1
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
  • ELISA
  • Proximity Ligation Assay
  • Sandwich ELISA
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HLA DQA1 Antibody (1A3)

• CD
• CELIAC1DQ alpha 1 chain
• DC-1 alpha chain
• DQ-A1
• FLJ27088
• FLJ27328
• GSE
• HLA class II histocompatibility antigen, DQ(W3) alpha chain
• HLA-DCA
• HLA-DQA
• leucocyte antigen DQA1
• leukocyte antigen alpha chain
• major histocompatibility complex, class II, DQ alpha 1
• MGC149527
• MHC class II antigen
• MHC class II DQA1
• MHC class II HLA-D alpha glycoprotein
• MHC class II HLA-DQ-alpha-1
• MHC class II surface glycoprotein
• MHC HLA-DQ alpha

Background

HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HLA-DQA1
• Entrez:
  • 3117(Human)
• Uniprot:
  • NP_002113(Human)