HLA DQA1 Antibody (1A3)

Images

 
Proximity Ligation Assay: HLA DQA1 Antibody (1A3) [H00003117-M01] - Analysis of protein-protein interactions between CD74 and HLA-DQA1. HeLa cells were stained with anti-CD74 rabbit purified polyclonal 1:1200 and ...read more
ELISA: HLA DQA1 Antibody (1A3) [H00003117-M01] - Detection limit for recombinant GST tagged HLA-DQA1 is 0.3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PLA, S-ELISA
Clone
1A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

HLA DQA1 Antibody (1A3) Summary

Immunogen
HLA-DQA1 (NP_002113.2, 24 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EDIVADHVASCGVNLYQFYGPSGQYTHEFDGDEEFYVDLERKETAWRWPEFSKFGGFDPQGALRNMAVAKHNLNIMIKRYNSTAATN
Specificity
HLA-DQA1 - major histocompatibility complex, class II, DQ alpha 1 (1A3)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HLA-DQA1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Proximity Ligation Assay
  • Sandwich ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for HLA DQA1 Antibody (1A3)

  • CD
  • CELIAC1DQ alpha 1 chain
  • DC-1 alpha chain
  • DQ-A1
  • FLJ27088
  • FLJ27328
  • GSE
  • HLA class II histocompatibility antigen, DQ(W3) alpha chain
  • HLA-DCA
  • HLA-DQA
  • leucocyte antigen DQA1
  • leukocyte antigen alpha chain
  • major histocompatibility complex, class II, DQ alpha 1
  • MGC149527
  • MHC class II antigen
  • MHC class II DQA1
  • MHC class II HLA-D alpha glycoprotein
  • MHC class II HLA-DQ-alpha-1
  • MHC class II surface glycoprotein
  • MHC HLA-DQ alpha

Background

HLA-DQA1 belongs to the HLA class II alpha chain paralogues. The class II molecule is a heterodimer consisting of an alpha (DQA) and a beta chain (DQB), both anchored in the membrane. It plays a central role in the immune system by presenting peptides derived from extracellular proteins. Class II molecules are expressed in antigen presenting cells (APC: B Lymphocytes, dendritic cells, macrophages). The alpha chain is approximately 33-35 kDa. It is encoded by 5 exons; exon 1 encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, and exon 4 encodes the transmembrane domain and the cytoplasmic tail. Within the DQ molecule both the alpha chain and the beta chain contain the polymorphisms specifying the peptide binding specificities, resulting in up to four different molecules. Typing for these polymorphisms is routinely done for bone marrow transplantation. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP2-25255
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-P
NBP2-25208
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1071
Species: Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-85466
Species: Hu, Mu, Fe
Applications: WB, IHC, IHC-P
6507-IL/CF
Species: Hu
NBP2-67605
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
MAB342
Species: Hu
Applications: WB, AgAct
NB100-77417
Species: Hu, Mu, Rt
Applications: WB, Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, In vivo, CyTOF-ready
NBP1-88220
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB100-1598
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP2-98675
Species: Hu
Applications: WB, IHC, IHC-P, IP

Publications for HLA DQA1 Antibody (H00003117-M01) (0)

There are no publications for HLA DQA1 Antibody (H00003117-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DQA1 Antibody (H00003117-M01) (0)

There are no reviews for HLA DQA1 Antibody (H00003117-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HLA DQA1 Antibody (H00003117-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HLA DQA1 Products

Bioinformatics Tool for HLA DQA1 Antibody (H00003117-M01)

Discover related pathways, diseases and genes to HLA DQA1 Antibody (H00003117-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA DQA1 Antibody (H00003117-M01)

Discover more about diseases related to HLA DQA1 Antibody (H00003117-M01).
 

Pathways for HLA DQA1 Antibody (H00003117-M01)

View related products by pathway.

PTMs for HLA DQA1 Antibody (H00003117-M01)

Learn more about PTMs related to HLA DQA1 Antibody (H00003117-M01).
 

Research Areas for HLA DQA1 Antibody (H00003117-M01)

Find related products by research area.

Blogs on HLA DQA1

There are no specific blogs for HLA DQA1, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA DQA1 Antibody (1A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DQA1
Entrez
Uniprot