HLA DOB Antibody - BSA Free

Immunohistochemistry-Paraffin: HLA DOB Antibody [NBP1-87469] - Staining in human tonsil and cerebral cortex tissues using anti-HLA-DOB antibody. Corresponding HLA-DOB RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: HLA DOB Antibody [NBP1-87469] - Staining of human tonsil shows high expression.

Immunohistochemistry-Paraffin: HLA DOB Antibody [NBP1-87469] - Staining of human cerebral cortex shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HLA DOB Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALIKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGD
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HLA-DOB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HLA DOB Protein (NBP1-87469PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HLA DOB Antibody - BSA Free

• DOB
• FLJ57033
• HLA class II histocompatibility antigen, DO beta chain
• major histocompatibility complex, class II, DO beta
• MHC class II antigen DOB

Background

HLA-DOB belongs to the HLA class II beta chain paralogues. This class II molecule is a heterodimer consisting of an alpha (DOA) and a beta chain (DOB), both anchored in the membrane. It is located in intracellular vesicles. DO suppresses peptide loading of MHC class II molecules by inhibiting HLA-DM. Class II molecules are expressed in antigen presenting cells (APC: B lymphocytes, dendritic cells, macrophages). The beta chain is approximately 26-28 kDa and its gene contains 6 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the two extracellular domains, exon 4 encodes the transmembrane domain and exon 5 encodes the cytoplasmic tail. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HLA DOB Antibody (NBP1-87469)(1)

Publication using NBP1-87469

• Liu C, Wang S, Zheng S et al. Avoiding Absolute Quantification Trap: A Novel Predictive Signature of Clinical Benefit to Anti-PD-1 Immunotherapy in Non-Small Cell Lung Cancer Frontiers in Immunology 2021-11-19 [PMID: 34868057] (Immunohistochemistry)

Bioinformatics

• Gene Symbol: HLA-DOB