HLA DOB Antibody

Images

 
Immunohistochemistry-Paraffin: HLA DOB Antibody [NBP1-87469] - Staining of human tonsil shows high expression.
Immunohistochemistry-Paraffin: HLA DOB Antibody [NBP1-87469] - Staining of human cerebral cortex shows low expression as expected.
Orthogonal Strategies: Immunohistochemistry-Paraffin: HLA DOB Antibody [NBP1-87469] - Staining in human tonsil and cerebral cortex tissues using anti-HLA-DOB antibody. Corresponding HLA-DOB RNA-seq data are ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

HLA DOB Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KADCYFTNGTEKVQFVVRFIFNLEEYVRFDSDVGMFVALIKLGQPDAEQWNSRLDLLERSRQAVDGVCRHNYRLGAPFTVGRKVQPEVTVYPERTPLLHQHNLLHCSVTGFYPGDIKIKWFLNGQEERAGVMSTGPIRNGD
Specificity
Specificity of human HLA DOB antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HLA-DOB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HLA DOB Protein (NBP1-87469PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HLA DOB Antibody

  • DOB
  • FLJ57033
  • HLA class II histocompatibility antigen, DO beta chain
  • major histocompatibility complex, class II, DO beta
  • MHC class II antigen DOB

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-26091
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-21590
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91993
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45312
Species: Hu, Pm, Mu(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IF
MAB5764
Species: Hu
Applications: Flow, IHC, CyTOF-ready
AF2864
Species: Hu
Applications: WB, IHC, ICC
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
NB100-64959
Species: Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr
H00003109-M06
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-84450
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IHC-WhMt
NBP2-53380
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56350
Species: Hu, Mu, Rt
Applications: WB
NBP3-10546
Species: Hu
Applications: WB
MAB6967
Species: Hu
Applications: WB
NBP2-01346
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00006890-M04
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP2-15698
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-86616
Species: Hu
Applications: WB, IHC, IHC-P

Publications for HLA DOB Antibody (NBP1-87469) (0)

There are no publications for HLA DOB Antibody (NBP1-87469).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HLA DOB Antibody (NBP1-87469) (0)

There are no reviews for HLA DOB Antibody (NBP1-87469). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HLA DOB Antibody (NBP1-87469) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HLA DOB Products

Bioinformatics Tool for HLA DOB Antibody (NBP1-87469)

Discover related pathways, diseases and genes to HLA DOB Antibody (NBP1-87469). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HLA DOB Antibody (NBP1-87469)

Discover more about diseases related to HLA DOB Antibody (NBP1-87469).
 

Pathways for HLA DOB Antibody (NBP1-87469)

View related products by pathway.

Research Areas for HLA DOB Antibody (NBP1-87469)

Find related products by research area.

Blogs on HLA DOB

There are no specific blogs for HLA DOB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HLA DOB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HLA-DOB