Histone H4 [ac Lys5] Antibody (10G1L0)

Images

 
Immunocytochemistry/ Immunofluorescence: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunofluorescence analysis of NIH-3T3 cells using Histone H4 Rabbit mAb.NIH-3T3 cells were treated by TSA (1 uM) at 37C for ...read more
Western Blot: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Western blot analysis of various lysates using Histone H4 Rabbit mAb at 1:1000 dilution. HeLa cells and NIH/3T3 cells and C6 cells were treated by TSA ...read more
Dot Blot: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Dot-blot analysis of all sorts of peptides using Histone H4 antibody at 1:1000 dilution.
Immunohistochemistry: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunohistochemistry analysis of paraffin-embedded Rat brain using Histone H4 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen ...read more
Immunohistochemistry: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunohistochemistry analysis of paraffin-embedded Human appendix using Histone H4 Rabbit mAb at dilution of 1:100 (40x lens). Microwave ...read more
Immunohistochemistry: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using Histone H4 Rabbit mAb at dilution of 1:100 (40x lens). Microwave antigen ...read more
Immunocytochemistry/ Immunofluorescence: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunofluorescence analysis of U-2 OS cells using Histone H4 Rabbit mAb.U-2 OS cells were treated by TSA (1 uM) at 37C for ...read more
Immunocytochemistry/ Immunofluorescence: Histone H4 [ac Lys5] Antibody (10G1L0) [NBP3-33198] - Immunofluorescence analysis of C6 cells using Histone H4 Rabbit mAb.C6 cells were treated by TSA (1 uM) at 37C for 18 ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, DB, ELISA, ICC/IF, IHC
Clone
10G1L0
Clonality
Monoclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Histone H4 [ac Lys5] Antibody (10G1L0) Summary

Immunogen
A synthetic acetylated peptide around K5 of human H4 Clustered Histone 1 (P62805).

Sequence:
MSGRGKGGKGLGKGGAKRHRKVLRDNIQGITKPAIRRLARRGGVKRISGLIYEETRGVLKVFLENVIRDAVTYTEHAKRKTVTAMDVVYALKRQGRTLYG
Modification
ac Lys5
Isotype
IgG
Clonality
Monoclonal
Host
Rabbit
Gene
H4C16
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Dot Blot 1:500 - 1:1000
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
Theoretical MW
11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol, 0.05% BSA
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Histone H4 [ac Lys5] Antibody (10G1L0)

  • H4
  • H4/A
  • H4/B
  • H4/C
  • H4/D
  • H4/E
  • H4/G
  • H4/H
  • H4/I
  • H4/J
  • H4/K
  • H4/M
  • H4/N
  • H4/O
  • H4/p
  • H4F2
  • H4FA
  • H4FB
  • H4FC
  • H4FD
  • H4FE
  • H4FG
  • H4FH
  • H4FI
  • H4FJ
  • H4FK
  • H4FM
  • H4FN
  • H4FO
  • H4M
  • HIST1H4A
  • HIST1H4B
  • HIST1H4C
  • HIST1H4D
  • HIST1H4E
  • HIST1H4F
  • HIST1H4H
  • HIST1H4I
  • HIST1H4J
  • HIST1H4K
  • HIST1H4L
  • HIST2H4
  • HIST2H4A
  • HIST2H4B
  • HIST4H4
  • histone 4, H4
  • Histone Cluster 1 H4
  • Histone Cluster 1 H4i
  • Histone Cluster 4 H4
  • histone cluster 4, H4
  • Histone H4
  • MGC24116

Background

Histone proteins H3, H4, H2A, and H2B function as building blocks to package eukaryotic DNA into repeating nucleosome units that are folded in higher order chromatin fibers. The nucleosome is composed of an octamer containing a H3/H4 tetramer and two H2A/H2B dimers, surrounded by approximately 146 base pairs of DNA. A diverse and elaborate array of post-translational modifications including acetylation, phosphorylation, methylation, ubiquitination, and ADP-ribosylation occurs on the N-terminal tail domains of histones. Methylation of position-specific lysine residues in histone N termini is a central modification for regulating epigenetic transitions in chromatin. Each methylatable lysine residue can exist in a mono, di, or tri methylated state. Arginine resdiues can also by mono or di methylated.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB500-171
Species: Hu, I, Mu, Rt, Xp, Ye
Applications: ChIP, IB, ICC/IF, IHC,  IHC-P, Single-Cell Western, WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-03993
Species: Bv, Ca, Hu, Mu, Pm
Applications: WB
NB100-56340
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr,  IHC-P, KO, Simple Western, WB
NBP3-48615
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, KD, WB
NBP1-91269
Species: Hu, Mu
Applications: ICC/IF (-), IHC (-), WB
H00007001-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
2695-SE
Species: Hu
Applications: EnzAct
NB100-1923
Species: Ce
Applications: IHC,  IHC-P, IP, WB
NB100-381
Species: Hu
Applications: ChIP, IP, WB
NBP1-87109
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NB100-1669
Species: Hu
Applications: ChIP, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NB100-55251
Species: Hu, Mu
Applications: IHC,  IHC-P, IP, WB
NBP1-85482
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-46085
Species: Hu
Applications: IHC,  IHC-P, WB
H00027065-M01
Species: Hu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
MAB3228
Species: Hu, Mu, Rt
Applications: ICC, KO, WB

Publications for Histone H4 Antibody (NBP3-33198) (0)

There are no publications for Histone H4 Antibody (NBP3-33198).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histone H4 Antibody (NBP3-33198) (0)

There are no reviews for Histone H4 Antibody (NBP3-33198). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Histone H4 Antibody (NBP3-33198) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Histone H4 Products

Blogs on Histone H4.

H4 - Monitoring global chromatin structure through histone modifications
Histones make up the main protein component of chromatin and are responsible for storing and organizing the genome in a compact yet accessible manner. In addition to storage, histones play an important role in the regulation of various cellular pro...  Read full blog post.

Histone H4 Phosphorylation: Affecting Liver Regeneration and Cancer
Histones are highly conserved proteins that function in the organization of nuclear DNA to create chromatin in eukaryotic cells. Post-translational alterations of histones are critical to monitoring and regulating DNA structure, expression, and gene t...  Read full blog post.

Histone H4: Implications in Liver Cancer
Histones are highly conserved proteins that function in the organization of nuclear DNA to create chromatin in eukaryotic cells. Post-translational alterations of histones are critical to monitoring and regulating DNA structure, expression, and gene t...  Read full blog post.

"Come Fly with Me" - New Drosophila Model Developed for Direct in Vivo Study of Histones
Forming the major protein component of chromatin, histones are essential to the structure and organization of chromosomes, forming the nucleosome around which DNA is packaged and wrapped.Antibody studies have revealed histones undergo various posttr...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Histone H4 [ac Lys5] Antibody (10G1L0) and receive a gift card or discount.

Bioinformatics

Gene Symbol H4C16