Histone H1t2 Antibody

Images

 
Immunohistochemistry: Histone H1t2 Antibody [NBP2-30774] - Staining of human testis shows moderate cytoplasmic and nuclear positivity in cells in seminiferus ducts

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Histone H1t2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: MEQALTGEAQSRWPRRGGSGAMAEAPGPSGESRGHSATQLPAEKTVGGPSRGCSSSVLRVSQLVLQAISTHKGLTLAALKKELGNAGYEVRRKS
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
H1FNT
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Histone H1t2 Protein (NBP2-30774PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Histone H1t2 Antibody

  • H1 Histone Family, Member N, Testis-Specific
  • H1FNT
  • H1T2
  • HANP1
  • Haploid Germ Cell-Specific Nuclear Protein 1
  • Testis-Specific H1 Histone

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56042
Species: Hu
Applications: IHC-P
NBP1-51641
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-31637
Species: Hu
Applications: IHC, IHC-P
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NB110-40662
Species: Hu, Mu, Rt, Ca
Applications: PEP-ELISA
NB100-2322
Species: Hu, Mu, Rt, Bv, Ca, Rb, Sh
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
MAB3616
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP1-93780
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-65220
Species: Hu, Rt, Po
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-69801
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IF
NBP1-77242
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NB100-56506
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, CyTOF-ready
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-29965
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31133
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB4605
Species: Hu
Applications: WB, Simple Western, ICC, ICFlow
NBP2-30774
Species: Hu
Applications: IHC, IHC-P

Publications for Histone H1t2 Antibody (NBP2-30774) (0)

There are no publications for Histone H1t2 Antibody (NBP2-30774).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Histone H1t2 Antibody (NBP2-30774) (0)

There are no reviews for Histone H1t2 Antibody (NBP2-30774). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Histone H1t2 Antibody (NBP2-30774) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Histone H1t2 Products

Bioinformatics Tool for Histone H1t2 Antibody (NBP2-30774)

Discover related pathways, diseases and genes to Histone H1t2 Antibody (NBP2-30774). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Histone H1t2 Antibody (NBP2-30774)

Discover more about diseases related to Histone H1t2 Antibody (NBP2-30774).
 

Pathways for Histone H1t2 Antibody (NBP2-30774)

View related products by pathway.

PTMs for Histone H1t2 Antibody (NBP2-30774)

Learn more about PTMs related to Histone H1t2 Antibody (NBP2-30774).

Blogs on Histone H1t2

There are no specific blogs for Histone H1t2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Histone H1t2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol H1FNT
Uniprot