HMGB4 Antibody

Images

 
Western Blot: HMGB4 Antibody [NBP1-93780] - Analysis in control (vector only transfected HEK293T lysate) and HMGB4 over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Orthogonal Strategies: Immunohistochemistry-Paraffin: HMGB4 Antibody [NBP1-93780] - Staining in human testis and endometrium tissues using anti-HMGB4 antibody. Corresponding HMGB4 RNA-seq data are presented for ...read more
Immunohistochemistry-Paraffin: HMGB4 Antibody [NBP1-93780] - Staining of human testis shows strong nuclear positivity in a subset of cells in seminiferus ducts.
Immunohistochemistry-Paraffin: HMGB4 Antibody [NBP1-93780] - Staining of human endometrium shows low expression as expected.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
       

Orthogonal Strategies

 

Order Details

HMGB4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: PPSSFLLFCQDHYAQLKRENPNWSVVQVAKATGKMWSTATDLEKHPYEQRVALLRAKYFEELELYRKQCNARKKYRMS
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HMGB4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HMGB4 Protein (NBP1-93780PEP)
Publications
Read Publication using NBP1-93780.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24309898)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HMGB4 Antibody

  • dJ1007G16.5
  • FLJ40388
  • high mobility group box 4
  • high mobility group protein B4
  • HMG2 like
  • MGC88128

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2322
Species: Bv, Ca, Hu, Mu, Rb, Rt, Sh
Applications: ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, Simple Western, WB
NBP3-16774
Species: Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, WB
MAB7957
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP2-47434
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-47752
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC, IHC-P, WB
NBP2-30774
Species: Hu
Applications: IHC, IHC-P
H00055079-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NB100-56598
Species: Hu, Mu
Applications: IHC, IHC-Fr, IHC-P, KD, WB

Publications for HMGB4 Antibody (NBP1-93780)(1)

Reviews for HMGB4 Antibody (NBP1-93780) (0)

There are no reviews for HMGB4 Antibody (NBP1-93780). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for HMGB4 Antibody (NBP1-93780) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional HMGB4 Products

Bioinformatics Tool for HMGB4 Antibody (NBP1-93780)

Discover related pathways, diseases and genes to HMGB4 Antibody (NBP1-93780). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HMGB4 Antibody (NBP1-93780)

Discover more about diseases related to HMGB4 Antibody (NBP1-93780).
 

Pathways for HMGB4 Antibody (NBP1-93780)

View related products by pathway.

PTMs for HMGB4 Antibody (NBP1-93780)

Learn more about PTMs related to HMGB4 Antibody (NBP1-93780).

Blogs on HMGB4

There are no specific blogs for HMGB4, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HMGB4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HMGB4