HIP1 Antibody - BSA Free

Western Blot: HIP1 Antibody [NBP1-81592] - Analysis in human cell lines A-549 and Caco-2 using Anti-HIP1 antibody. Corresponding HIP1 RNA-seq data are presented for the same cell lines. Loading control: Anti-PPIB.

Immunocytochemistry/Immunofluorescence: HIP1 Antibody [NBP1-81592] - Staining of human cell line U-251 MG shows localization to vesicles.

Immunohistochemistry-Paraffin: HIP1 Antibody [NBP1-81592] - Staining of human testis using Anti-HIP1 antibody NBP1-81592.

Western Blot: HIP1 Antibody [NBP1-81592] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.

Immunohistochemistry-Paraffin: HIP1 Antibody [NBP1-81592] - Analysis in human testis and liver tissues using Anti-HIP1 antibody. Corresponding HIP1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: HIP1 Antibody [NBP1-81592] - Staining of human testis shows high expression.

Immunohistochemistry-Paraffin: HIP1 Antibody [NBP1-81592] - Staining in human testis and liver tissues using anti-HIP1 antibody. Corresponding HIP1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: HIP1 Antibody [NBP1-81592] - Staining of human colon, kidney, liver and testis using Anti-HIP1 antibody NBP1-81592 (A) shows similar protein distribution across tissues to independent antibody NBP1-81593 (B).

Immunohistochemistry-Paraffin: HIP1 Antibody [NBP1-81592] - Staining of human colon.

Immunohistochemistry-Paraffin: HIP1 Antibody [NBP1-81592] - Staining of human kidney.

Immunohistochemistry-Paraffin: HIP1 Antibody [NBP1-81592] - Staining of human liver using Anti-HIP1 antibody NBP1-81592.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HIP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HIP1 Antibody - BSA Free (NBP1-81592) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-HIP1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: NFLRASALSEHISPVVVIPAEASSPDSEPVLEKDDLMDMDASQQNLFDNKFDDIFGSSFSSDPFNFNSQNGVNKDEKDHLIERLYREISGLKAQLENMKTESQRVVLQLKGHVSELEADLAEQQHLRQQAADDCEFLRAELDELRRQRED
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HIP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HIP1 Protein (NBP1-81592PEP)

Reactivity Notes

Reactivity reported in scientific literature (PMID: 24852344)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HIP1 Antibody - BSA Free

• HIP-1
• HIP-I
• huntingtin interacting protein 1
• huntingtin-interacting protein 1
• Huntingtin-interacting protein I
• ILWEQ
• MGC126506

Background

Huntingtin Interacting Protein (HIP1) is a reportedly proapoptotic, cargo-specific adaptor protein that may be involved in the pathogenesis of Huntingtin's disease. Huntingtin's is a neurodegenerate disease caused by the expansion of a polymorphic glutamine tract in Huntingtin.

In addition to playing a role in Huntingtin disease, HIP1 is likely to be involved in the recruitment of clathrin coats to lipid membranes, and it may also factor in tumorigenesis by allowing the survival of precancerous and cancerous cells. Since HIP-1 expression is significantly associated with prostate and colon cancer metastasis, HIP-1 can serve as a putative prognostic factor for prostate and colon cancers.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HIP1 Antibody (NBP1-81592)(1)

Publication using NBP1-81592

• Majeed SR, Vasudevan L, Chen CY et al. Clathrin light chains are required for the gyrating-clathrin recycling pathway and thereby promote cell migration. Nat Commun 2014-05-23 [PMID: 24852344]

Bioinformatics

• Gene Symbol: HIP1