Independent Antibodies: Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human fallopian tube, gastrointestinal, kidney and testis using Anti-HINT2 antibody NBP1-86024 (A) shows similar ...read more
Western Blot: HINT2 Antibody [NBP1-86024] - Analysis in human cell line PC-3.
Immunocytochemistry/ Immunofluorescence: HINT2 Antibody [NBP1-86024] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
This antibody was developed against Recombinant Protein corresponding to amino acids: IPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HINT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
IHC reported in scientific literature (PMID: 28947137). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified
Alternate Names for HINT2 Antibody
EC 3.-
HINT-2
HINT-3
histidine triad nucleotide binding protein 2
histidine triad nucleotide-binding protein 2, mitochondrial
HIT-17
HIT-17kDa
PKCI-1-related HIT protein
protein kinase C inhibitor-2
Background
Histidine triad proteins, such as HINT2, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
Bioinformatics Tool for HINT2 Antibody (NBP1-86024)
Discover related pathways, diseases and genes to HINT2 Antibody (NBP1-86024). Need help?
Read the Bioinformatics Tool Guide for instructions on using this tool.
Diseases for HINT2 Antibody (NBP1-86024)
Discover more about diseases related to HINT2 Antibody (NBP1-86024).
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our HINT2 Antibody and receive a gift card or discount.