HINT2 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HINT2 Antibody [NBP1-86024] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human fallopian tube, gastrointestinal, kidney and testis using Anti-HINT2 antibody NBP1-86024 (A) shows similar protein distribution across tissues to independent antibody NBP2-56156 (B).

Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.

Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

Analysis in human cell line PC-3.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HINT2 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: IPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HINT2
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HINT2 Protein (NBP1-86024PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HINT2 Antibody - BSA Free

• EC 3.-
• HINT-2
• HINT-3
• histidine triad nucleotide binding protein 2
• histidine triad nucleotide-binding protein 2, mitochondrial
• HIT-17
• HIT-17kDa
• PKCI-1-related HIT protein
• protein kinase C inhibitor-2

Background

Histidine triad proteins, such as HINT2, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for HINT2 Antibody (NBP1-86024)(2)

Publications using NBP1-86024

• Wang Y, Hsu S, Tsai H et al. Transcriptomic and Proteomic Analysis of CRISPR/Cas9-Mediated ARC-Knockout HEK293 Cells International Journal of Molecular Sciences [PMID: 35562887] (WB, Human)
• Chen L, Sun Q, Zhou D et al. HINT2 triggers mitochondrial Ca(2+) influx by regulating the mitochondrial Ca(2+) uniporter (MCU) complex and enhances gemcitabine apoptotic effect in pancreatic cancer Cancer Lett. 2017-09-23 [PMID: 28947137] (IF/IHC, Human)

Bioinformatics

• Gene Symbol: HINT2