After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.
Immunocytochemistry/ Immunofluorescence: HINT2 Antibody [NBP1-86024] - Staining of human cell line U-2 OS shows localization to mitochondria. Antibody staining is shown in green.
Independent Antibodies: Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human fallopian tube, gastrointestinal, kidney and testis using Anti-HINT2 antibody NBP1-86024 (A) shows similar ...read more
Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human testis shows strong granular cytoplasmic positivity in Leydig cells.
Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human duodenum shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human fallopian tube shows moderate granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: HINT2 Antibody [NBP1-86024] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.
Analysis in human cell line PC-3.
HINT2 attenuates hepatic steatosis, inflammation, fibrosis and mitochondrial damage in MASH mice.a WT and Hint2−/− mice were fed a WDSW for 24 weeks. b Body weights of the mice. c Serum liver enzymes of the mice. d ...read more
This antibody was developed against Recombinant Protein corresponding to amino acids: IPRISQAEEEDQQLLGHLLLVAKQTAKAEGLGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HINT2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (88%), Rat (89%)
Packaging, Storage & Formulations
Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified
Alternate Names for HINT2 Antibody - BSA Free
EC 3.-
HINT-2
HINT-3
histidine triad nucleotide binding protein 2
histidine triad nucleotide-binding protein 2, mitochondrial
HIT-17
HIT-17kDa
PKCI-1-related HIT protein
protein kinase C inhibitor-2
Background
Histidine triad proteins, such as HINT2, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
=
÷
Review this Product
Be the first to review our HINT2 Antibody - BSA Free and receive a gift card or discount.