HINT3 Antibody - BSA Free

Western Blot: HINT3 Antibody [NBP1-81981] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4.

Immunocytochemistry/Immunofluorescence: HINT3 Antibody [NBP1-81981] - Staining of human cell line A-431 shows positivity in nucleoli, cytoplasm & mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: HINT3 Antibody [NBP1-81981] - Staining of human tonsil shows no positivity in germinal center cells as expected.

Immunohistochemistry-Paraffin: HINT3 Antibody [NBP1-81981] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: HINT3 Antibody [NBP1-81981] - Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: HINT3 Antibody [NBP1-81981] - Staining of human prostate shows moderate cytoplasmic positivity in glandular cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HINT3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HINT3 Antibody - BSA Free (NBP1-81981) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAEEQVNRSAGLAPDCEASATAETTVSSVGTCEAAAKSPEPKDYDSTCVFCRIAGRQDPGTELLHCENEDLICFKDIKPAATHHYLVVP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HINT3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Theoretical MW: 20 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
• Control Peptide:

  HINT3 Protein (NBP1-81981PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HINT3 Antibody - BSA Free

• EC 3.-
• FLJ33126
• FLJ99898
• HINT-3
• HINT4
• histidine triad nucleotide binding protein 3
• histidine triad nucleotide-binding protein 3
• HIT-like protein
• MGC22976

Background

Histidine triad proteins, such as HINT3, are nucleotide hydrolases and transferases that act on the alpha-phosphate of ribonucleotides (Brenner, 2002 [PubMed 12119013]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HINT3
• Entrez:
  • 135114(Human)
• Uniprot:
  • Q9NQE9(Human)