HINT1 Antibody


Western Blot: HINT1 Antibody [NBP1-83257] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: HINT1 Antibody [NBP1-83257] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & cytosol.
Immunohistochemistry-Paraffin: HINT1 Antibody [NBP1-83257] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts.
Western Blot: HINT1 Antibody [NBP1-83257] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane ...read more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

HINT1 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: IPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVL
Specificity of human, mouse, rat HINT1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Positive Control
HINT1 Lysate (NBP2-65336)
Control Peptide
HINT1 Protein (NBP1-83257PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for HINT1 Antibody

  • Adenosine 5'-monophosphoramidase
  • EC 3.-
  • HINT
  • histidine triad nucleotide binding protein 1
  • histidine triad nucleotide-binding protein 1
  • histidine triad nucleotide-binding protein
  • PKCI1
  • PKCI-1FLJ30414
  • PRKCNH1FLJ32340
  • Protein kinase C inhibitor 1
  • Protein kinase C-interacting protein 1


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, PLA, ICC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for HINT1 Antibody (NBP1-83257) (0)

There are no publications for HINT1 Antibody (NBP1-83257).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HINT1 Antibody (NBP1-83257) (0)

There are no reviews for HINT1 Antibody (NBP1-83257). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for HINT1 Antibody (NBP1-83257) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Positive Control Lysate(s)

Secondary Antibodies


Isotype Controls

Additional HINT1 Products

Bioinformatics Tool for HINT1 Antibody (NBP1-83257)

Discover related pathways, diseases and genes to HINT1 Antibody (NBP1-83257). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HINT1 Antibody (NBP1-83257)

Discover more about diseases related to HINT1 Antibody (NBP1-83257).

Pathways for HINT1 Antibody (NBP1-83257)

View related products by pathway.

PTMs for HINT1 Antibody (NBP1-83257)

Learn more about PTMs related to HINT1 Antibody (NBP1-83257).

Blogs on HINT1

There are no specific blogs for HINT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our HINT1 Antibody and receive a gift card or discount.


Gene Symbol HINT1