HEXO Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: HEXO Antibody [NBP2-38756] - Staining of human cell line A-431 shows localization to microtubules & vesicles.

Immunohistochemistry: HEXO Antibody [NBP2-38756] - Staining of human stomach shows strong cytoplasmic positivity in glandular cells.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HEXO Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HEXO Antibody - BSA Free (NBP2-38756) is a polyclonal antibody validated for use in IHC and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FYKVPRSQTKLTIMLEKLGMDYDGRPHCGLDDSKNIARIAVRMLQDGCELRINEKMHAGQLMSVSSS
• Predicted Species: Mouse (93%), Rat (96%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ERI1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  HEXO Protein (NBP2-38756PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for HEXO Antibody - BSA Free

• 3' exoribonuclease
• 3'-5' exonuclease ERI1
• 3'EXO
• 3'HEXO
• EC 3.1
• enhanced RNAi three prime mRNA exonuclease homolog 1
• Eri-1 homolog
• exoribonuclease 1
• HEXO
• histone mRNA 3' end-specific exonuclease
• Histone mRNA 3'-end-specific exoribonuclease
• Histone mRNA 3'-exonuclease 1
• MGC35395
• Protein 3'hExo
• THEX1
• three prime histone mRNA exonuclease 1,3'-5' exoribonuclease 1
• three prime mRNA exonuclease 1

Background

HEXO is a 50-kD protein containing a SAP domain capable of recognizing AT-rich scaffold-attachment regions (SARs) in chromosomal DNA, and a exonuclease domain similar to those of DEDD exonuclease family members. HEXO is an RNA exonuclease that binds to the 3' end of histone mRNAs and probably degrades them, suggesting that it plays an essential role in histone mRNA decay after replication. It is also able to degrade the 3' overhangs of short interfering RNAs (siRNAs) in vitro, suggesting a possible role as a regulator of RNA interference (RNAi).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ERI1
• Uniprot:
  • Q8IV48(Human)