MTCO1 Antibody

Western Blot: MTCO1 Antibody [NBP2-94458] - Analysis of extracts of various cell lines, using MTCO1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit. Exposure time: 30s.

Immunocytochemistry/Immunofluorescence: MTCO1 Antibody [NBP2-94458] - Analysis of PC-12 cells using MTCO1 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.

Immunohistochemistry-Paraffin: MTCO1 Antibody [NBP2-94458] - Mouse heart using MTCO1 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: MTCO1 Antibody [NBP2-94458] - Rat kidney using MTCO1 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: MTCO1 Antibody [NBP2-94458] - Rat brain using MTCO1 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: MTCO1 Antibody [NBP2-94458] - Mouse kidney using MTCO1 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

MTCO1 Antibody Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human MTCO1 (YP_002124304.1). FSGYTLDQTYAKIHFTIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLYGCPP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: COX1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/Immunofluorescence 1:50 - 1:100
  • Immunohistochemistry 1:50-1:100
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 57 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.05% Proclin 300
• Purity: Affinity purified

Alternate Names for MTCO1 Antibody

• COI
• COX1
• MTCO1
• MT-COI mitochondrially encoded cytochrome c oxidase I
• MT-COI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: COX1