MTCO1 Antibody - Azide and BSA Free

Images

 
Western Blot: MTCO1 Antibody [NBP2-94458] - Analysis of extracts of various cell lines, using MTCO1 antibody at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: ...read more
Immunocytochemistry/ Immunofluorescence: MTCO1 Antibody [NBP2-94458] - Analysis of PC-12 cells using MTCO1 Rabbit pAb at dilution of 1:150 (40x lens). Blue: DAPI for nuclear staining.
Immunohistochemistry-Paraffin: MTCO1 Antibody [NBP2-94458] - Mouse heart using MTCO1 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing ...read more
Immunohistochemistry-Paraffin: MTCO1 Antibody [NBP2-94458] - Rat kidney using MTCO1 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing ...read more
Immunohistochemistry-Paraffin: MTCO1 Antibody [NBP2-94458] - Rat brain using MTCO1 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing ...read more
Immunohistochemistry-Paraffin: MTCO1 Antibody [NBP2-94458] - Mouse kidney using MTCO1 Rabbit pAb at dilution of 1:150 (40x lens).Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
Azide and BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

MTCO1 Antibody - Azide and BSA Free Summary

Immunogen
A synthetic peptide corresponding to a sequence within amino acids 400-500 of human MTCO1 (YP_002124304.1). FSGYTLDQTYAKIHFTIMFIGVNLTFFPQHFLGLSGMPRRYSDYPDAYTTWNILSSVGSFISLTAVMLMIFMIWEAFASKRKVLMVEEPSMNLEWLYGCPP
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
COX1
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
Theoretical MW
57 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.3), 50% glycerol
Preservative
0.05% Proclin 300
Purity
Affinity purified

Alternate Names for MTCO1 Antibody - Azide and BSA Free

  • COI
  • COX1
  • MTCO1
  • MT-COI mitochondrially encoded cytochrome c oxidase I
  • MT-COI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MTCO1 Antibody (NBP2-94458) (0)

There are no publications for MTCO1 Antibody (NBP2-94458).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MTCO1 Antibody (NBP2-94458) (0)

There are no reviews for MTCO1 Antibody (NBP2-94458). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MTCO1 Antibody (NBP2-94458) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MTCO1 Products

Research Areas for MTCO1 Antibody (NBP2-94458)

Find related products by research area.

Blogs on MTCO1

There are no specific blogs for MTCO1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MTCO1 Antibody - Azide and BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol COX1