HEXB Antibody - BSA Free

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211] - Staining of human prostate shows moderate to strong granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211] - Staining of human epididymis shows granular cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211] - Staining of human colon, epididymis, kidney and liver using Anti-HEXB antibody NBP2-49211 (A) shows similar protein distribution across tissues to independent antibody NBP2-48689 (B).

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211] - Staining of human kidney shows moderate to strong granular cytoplasmic positivity in cells in tubules.

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211] - Staining of human colon.

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211] - Staining of human gastrointestinal shows moderate to strong granular cytoplasmic positivity in cells in lamina propria.

Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-49211] - Staining of human liver shows very weak granular cytoplasmic positivity in hepatocytes.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

HEXB Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit HEXB Antibody - BSA Free (NBP2-49211) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FGFYKWHHEPAEFQAKTQVQQLLVSITLQSECDAFPNISSDESYTLLVKEPVAVLKANRVW
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HEXB
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  HEXB Recombinant Protein Antigen (NBP2-49211PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for HEXB Antibody - BSA Free

• beta-hexosaminidase subunit beta
• Beta-N-acetylhexosaminidase subunit beta
• Cervical cancer proto-oncogene 7 protein
• EC 3.2.1.52
• ENC-1AS
• HCC-7
• HEL-248
• HEXB
• hexosaminidase B (beta polypeptide)
• Hexosaminidase B
• Hexosaminidase subunit B
• N-acetyl-beta-glucosaminidase subunit beta

Background

HEXB, also known as Beta-hexosaminidase subunit beta, is a 556 amino acid that is 63 kDa, lysosome located, composed of two subunits, alpha and beta, which are encoded by separate gene, and in control of the degradation of GM2 gangliosides and other molecules containing terminal N-acetyl hexosamines, in the brain and other tissues. Current research is being performed on several diseases and disorders including gangliosidosis, sandhoff disease, infantile, juvenile, and adult forms, tay-sachs disease, neuronitis, lysosomal storage disease, motor neuron disease, cervical cancer, mucopolysaccharidosis, cervicitis, neurodegenerative disease, recurrent respiratory papillomatosis, hairy cell leukemia, macrocephaly, autonomic dysfunction, cholesteatoma, type 2 diabetes mellitus, rheumatoid arthritis, and diarrhea. The protein has been linked to pathways such as glycan degradation, amino sugar and nucleotide sugar metabolism, glycosaminoglycan degradation, glycosphingolipid biosynthesis - globo series, glycosphingolipid biosynthesis - ganglio series, MPS VI - Maroteaux-Lamy syndrome, metabolic pathways, and lysosome pathways where it interacts with EIF2D, GYG1, CSNK2B, CHIA,CHIT1, and CHIT1 proteins.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for HEXB Antibody (NBP2-49211) (1)

Average Rating: 1

(Based on 1 review)

We have 1 review tested in 1 species: Mouse.

reviewed by: Verified Customer IHC-Fr Mouse 06/20/2023

Summary

• Application: Immunohistochemistry-Frozen
• Sample Tested: mouse spinal cord
• Species: Mouse
• Lot: A117403

Comments

• Comments: ***Bio-Techne Response: This review was submitted through the legacy Novus Innovators Program, reflecting a new species or application tested on a primary antibody.***

Bioinformatics

• Gene Symbol: HEXB