HEXB Antibody

Images

 
Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-48689] - Staining of human epididymis.
Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-48689] - Staining of human epididymis shows granular cytoplasmic positivity in glandular cells.
Independent Antibodies: Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-48689] - Staining of human colon, epididymis, kidney and liver using Anti-HEXB antibody NBP2-48689 (A) shows similar protein distribution ...read more
Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-48689] - Staining of human kidney.
Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-48689] - Staining of human colon.
Immunohistochemistry-Paraffin: HEXB Antibody [NBP2-48689] - Staining of human liver.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Validated by:
 

Independent Antibodies

       

Order Details

HEXB Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PSVSAKPGPALWPLPLSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HEXB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
HEXB Recombinant Protein Antigen (NBP2-48689PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for HEXB Antibody

  • beta-hexosaminidase subunit beta
  • Beta-N-acetylhexosaminidase subunit beta
  • Cervical cancer proto-oncogene 7 protein
  • EC 3.2.1.52
  • ENC-1AS
  • HCC-7
  • HEL-248
  • HEXB
  • hexosaminidase B (beta polypeptide)
  • Hexosaminidase B
  • Hexosaminidase subunit B
  • N-acetyl-beta-glucosaminidase subunit beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6237
Species: Hu
Applications: WB, IHC
H00003087-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-16382
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-02623
Species: Hu, Mu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87090
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-58917
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-86615
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-83574
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4415
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-80917
Species: Hu
Applications: WB, IHC, IHC-P
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-48820
Species: Hu
Applications: IHC, IHC-P
NBP1-88927
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
MAB25031
Species: Hu
Applications: WB, IHC, IP

Publications for HEXB Antibody (NBP2-48689) (0)

There are no publications for HEXB Antibody (NBP2-48689).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for HEXB Antibody (NBP2-48689) (0)

There are no reviews for HEXB Antibody (NBP2-48689). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for HEXB Antibody (NBP2-48689) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional HEXB Products

Bioinformatics Tool for HEXB Antibody (NBP2-48689)

Discover related pathways, diseases and genes to HEXB Antibody (NBP2-48689). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for HEXB Antibody (NBP2-48689)

Discover more about diseases related to HEXB Antibody (NBP2-48689).
 

Pathways for HEXB Antibody (NBP2-48689)

View related products by pathway.

PTMs for HEXB Antibody (NBP2-48689)

Learn more about PTMs related to HEXB Antibody (NBP2-48689).
 

Research Areas for HEXB Antibody (NBP2-48689)

Find related products by research area.

Blogs on HEXB

There are no specific blogs for HEXB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our HEXB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HEXB