Hepsin Antibody

Images

 
Western Blot: Hepsin Antibody [NBP1-86931] - Analysis in control (vector only transfected HEK293T lysate) and HPN over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).
Immunohistochemistry-Paraffin: Hepsin Antibody [NBP1-86931] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Hepsin Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FDKTEGTWRLLCSSRSNARVAGLSCEEMGFLRALTHSELDVRTAGANGTSGFFCVDEGRLPHTQRLLEVISVCDCPRGRFLAAICQDCGRRKLPVDRIVGGRDTSLGRWPWQVSLRYDGAHL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HPN
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
Hepsin Protein (NBP1-86931PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Hepsin Antibody

  • EC 3.4.21
  • EC 3.4.21.106
  • Hepsin
  • HPN
  • serine protease hepsin catalytic chain
  • serine protease hepsin
  • TMPRSS1
  • TMPRSS1serine protease hepsin non-catalytic chain
  • Transmembrane protease serine 1
  • transmembrane protease, serine 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1141
Species: Mu
Applications: WB, IHC, IP
NBP1-82268
Species: Hu
Applications: WB, IHC, IHC-P
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP2-38263
Species: Hu
Applications: WB, IHC, IHC-P
AF4599
Species: Hu
Applications: WB, Simple Western, IHC, IP
NBP1-28884
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF4036
Species: Hu
Applications: WB, Simple Western
H00005324-M02
Species: Hu
Applications: WB, ELISA, IHC
AF1310
Species: Hu
Applications: WB, IHC, IP
NBP1-32920
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF3946
Species: Hu
Applications: WB, CyTOF-ready, ICFlow

Publications for Hepsin Antibody (NBP1-86931) (0)

There are no publications for Hepsin Antibody (NBP1-86931).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hepsin Antibody (NBP1-86931) (0)

There are no reviews for Hepsin Antibody (NBP1-86931). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hepsin Antibody (NBP1-86931) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hepsin Products

Bioinformatics Tool for Hepsin Antibody (NBP1-86931)

Discover related pathways, diseases and genes to Hepsin Antibody (NBP1-86931). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hepsin Antibody (NBP1-86931)

Discover more about diseases related to Hepsin Antibody (NBP1-86931).
 

Pathways for Hepsin Antibody (NBP1-86931)

View related products by pathway.

PTMs for Hepsin Antibody (NBP1-86931)

Learn more about PTMs related to Hepsin Antibody (NBP1-86931).
 

Research Areas for Hepsin Antibody (NBP1-86931)

Find related products by research area.

Blogs on Hepsin

There are no specific blogs for Hepsin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hepsin Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HPN
Entrez