Recombinant Human Hepcidin Antimicrobial Peptide Protein

Images

 
Recombinant Human Hepcidin Antimicrobial Peptide Protein [H00057817-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Hepcidin Antimicrobial Peptide Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 25-84 of Human HAMP full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Recombinant Protein
Gene
HAMP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
32.34 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using
H00057817-P01 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Hepcidin Antimicrobial Peptide Protein

  • HAMP
  • HEPC
  • hepcidin antimicrobial peptide
  • Hepcidin
  • HEPCPutative liver tumor regressor
  • HFE2B
  • HFE2Bhepcidin
  • LEAP1
  • LEAP-1
  • LEAP1PLTR
  • Liver-expressed antimicrobial peptide 1
  • PLTR

Background

HAMP( AAH20612, 25 a.a. - 85 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3720
Species: Hu, Mu
Applications: WB, ICC
7270-IL/CF
Species: Hu
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
MAB3120
Species: Hu
Applications: WB, Simple Western
NBP1-21502
Species: Hu, Mu, Po, Bv
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
H00004891-M01
Species: Hu
Applications: WB, ELISA, IHC-P
AF7509
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP1-84071
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-12553
Species: Hu
8146-GD/CF
Species: Hu
NBP2-13967
Species: Hu
Applications: IHC, IHC-P
H00057817-P01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Hepcidin Antimicrobial Peptide Recombinant Protein (H00057817-P01)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Hepcidin Antimicrobial Peptide Recombinant Protein (H00057817-P01) (0)

There are no reviews for Hepcidin Antimicrobial Peptide Recombinant Protein (H00057817-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hepcidin Antimicrobial Peptide Recombinant Protein (H00057817-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Hepcidin Antimicrobial Peptide Recombinant Protein (H00057817-P01)

Discover related pathways, diseases and genes to Hepcidin Antimicrobial Peptide Recombinant Protein (H00057817-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hepcidin Antimicrobial Peptide Recombinant Protein (H00057817-P01)

Discover more about diseases related to Hepcidin Antimicrobial Peptide Recombinant Protein (H00057817-P01).
 

Pathways for Hepcidin Antimicrobial Peptide Recombinant Protein (H00057817-P01)

View related products by pathway.

PTMs for Hepcidin Antimicrobial Peptide Recombinant Protein (H00057817-P01)

Learn more about PTMs related to Hepcidin Antimicrobial Peptide Recombinant Protein (H00057817-P01).

Blogs on Hepcidin Antimicrobial Peptide

There are no specific blogs for Hepcidin Antimicrobial Peptide, but you can read our latest blog posts.

Customers Who Bought This Also Bought

IL-6 [Unconjugated]
7270-IL-025/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Hepcidin Antimicrobial Peptide Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol HAMP
Entrez