TfR2 Antibody - BSA Free

Western Blot: TfR2 Antibody [NBP2-93436] - Western blot analysis of extracts of various cell lines, using TfR2 antibody (NBP2-93436) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunohistochemistry-Paraffin: TfR2 Antibody [NBP2-93436] - Immunohistochemistry of paraffin-embedded human liver cancer using TfR2 antibody (NBP2-93436) at dilution of 1:100 (40x lens). Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IHC staining protocol.

Immunocytochemistry/ Immunofluorescence: TfR2 Antibody - Azide and BSA Free [NBP2-93436] - Immunofluorescence analysis of HepG2 cells using TfR2 Rabbit pAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TfR2 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TfR2 Antibody - BSA Free (NBP2-93436) is a polyclonal antibody validated for use in IHC, WB, ELISA and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 130-330 of human TFR2 (NP_003218.2). FHQGRLYWSDLQAMFLQFLGEGRLEDTIRQTSLRERVAGSAGMAALTQDIRAALSRQKLDHVWTDTHYVGLQFPDPAHPNTLHWVDEAGKVGEQLPLEDPDVYCPYSAIGNVTGELVYAHYGRPEDLQDLRARGVDPVGRLLLVRVGVISFAQKVTNAQDFGAQGVLIYPEPADFSQDPPKPSLSSQQAVYGHVHLGTGDP
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TFR2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 89 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.09% Sodium Azide
• Purity: Affinity purified

Alternate Names for TfR2 Antibody - BSA Free

• HFE3
• HFE3transferrin receptor protein 2
• MGC126368
• TfR2
• TFRC2
• transferrin receptor 2

Background

TFR2 is a gene that codes for a protein with three isoforms, with lengths of 801, 630, and 774 amino acids and weights of approximately 89, 70, and 86 kDa respectively. TFR2 helps in the cellular uptake of transferrin-bound iron as well as iron metabolism, erythrocyte differentiation, and hepatocyte function. Current studies are being done on several diseases and disorders related to this gene including porphyria cutanea tarda, iron overload, beta thalassemia, liver cirrhosis, hepatitis C, fatty liver disease, leukemia, lymphoma, liver disease, and cystic fibrosis. TRF2 has also been shown to have interactions with HFE, TF, UBC, and SOCS3 in pathways such as the AMPK enzyme complex and iron metabolism in the placenta pathways.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: TFR2