Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody

Images

 
Western Blot: Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody [NBP2-56735] - Analysis in human cell line RT-4, human cell line U-251 MG, human plasma, human liver tissue and human tonsil tissue.
Immunocytochemistry/ Immunofluorescence: Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody [NBP2-56735] - Staining of human cell line U-2 OS shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: CQLLRLQAFSSPVPDPYRSEDESSARFVPRYNFTRGDLLRKVDFDIKGDDLIVFLHIQK
Specificity
Specificity of human Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
HS6ST2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Recombinant Protein Antigen (NBP2-56735PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody

  • EC-1
  • heparan sulfate 6-O-sulfotransferase 2
  • HS6ST2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5057
Species: Hu
Applications: WB
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5406
Species: Mu
Applications: IHC
NBP2-31584
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-50599
Species: Hu
Applications: WB, ELISA, Flow, IHC, IP, CyTOF-ready
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-36727
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC, IHC-P, IP, CyTOF-ready
NBP1-91982
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB600-1287
Species: Hu, Mu, Rt, Rb
Applications: WB, Flow, IHC, IP, CyTOF-ready
NBP1-90906
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NBP2-56735
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody (NBP2-56735) (0)

There are no publications for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody (NBP2-56735).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody (NBP2-56735) (0)

There are no reviews for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody (NBP2-56735). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody (NBP2-56735) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Products

Bioinformatics Tool for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody (NBP2-56735)

Discover related pathways, diseases and genes to Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody (NBP2-56735). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody (NBP2-56735)

Discover more about diseases related to Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody (NBP2-56735).
 

Pathways for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody (NBP2-56735)

View related products by pathway.

PTMs for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody (NBP2-56735)

Learn more about PTMs related to Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody (NBP2-56735).

Blogs on Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2

There are no specific blogs for Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Heparan Sulfate 6-O-Sulfotransferase 2/HS6ST2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol HS6ST2