Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP2-57855] - Staining of human cell line RT4 shows localization to nucleus & mitochondria.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody - BSA Free (NBP2-57855) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GATELYRTGKKSHLRKTTEKKLPTKQTIAKLQQSDIWKMENEFYEFALEQFQFIRAHAVREKDGDLYILAQ
• Predicted Species: Mouse (99%), Rat (97%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: HS2ST1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Recombinant Protein Antigen (NBP2-57855PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody - BSA Free

• 2OST
• 2-O-sulfotransferase
• EC 2.8.2
• EC 2.8.2.-
• FLJ11317
• heparan sulfate 2-O-sulfotransferase 1
• HS2ST
• HS2ST1
• KIAA0448dJ604K5.2
• MGC131986

Background

Heparan sulfate biosynthetic enzymes are key components in generating a myriad of distinct heparan sulfate fine structures that carry out multiple biologic activities. This gene encodes heparan sulfate 2-O-sulfotransferase, a member of the heparan sulfate biosynthetic enzyme family. This family member transfers sulfate to the 2 position of the iduronic acid residue of heparan sulfate. The disruption of this gene resulted in no kidney formation in knockout embryonic mice, indicating that the absence of this enzyme may interfere with the signaling required for kidney formation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: HS2ST1