N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10)

Images

 
Western Blot: N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10) [H00003340-M01] - NDST1 monoclonal antibody (M01), clone 1G10 Analysis of NDST1 expression in A-549.
Immunohistochemistry-Paraffin: N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10) [H00003340-M01] - Analysis of monoclonal antibody to NDST1 on formalin-fixed paraffin-embedded human small Intestine. Antibody ...read more
Western Blot: N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10) [H00003340-M01] - Western Blot analysis of NDST1 expression in A-549 ( Cat # L025V1 ).
Sandwich ELISA: N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10) [H00003340-M01] - Detection limit for recombinant GST tagged NDST1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC
Clone
1G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10) Summary

Description
Quality control test: Antibody Reactive Against Recombinant Protein.
Immunogen
NDST1 (NP_001534, 38 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI
Specificity
NDST1 - N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDST1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publication using H00003340-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10)

  • [Heparan sulfate]-glucosamine N-sulfotransferase 1
  • bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1
  • EC 2.8.2.8
  • Glucosaminyl N-deacetylase/N-sulfotransferase 1
  • heparan sulfate-N-deacetylase/N-sulfotransferase
  • HSNST 1
  • HSNST1
  • HSST1
  • HSSTN-HSST 1
  • N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1
  • NDST1
  • NDST-1
  • N-heparan sulfate sulfotransferase 1
  • NST1

Background

Essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine(GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA dissacharide repeating sugar backboneto make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Plays a rolein determining the extent and pattern of sulfation of heparan sulfate. Compared to other NDST enzymes, its presence isabsolutely required. Participates in biosynthesis of heparan sulfate that can ultimately serve as L-selectin ligands,thereby playing a role in inflammatory response

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-81747
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP2-23603
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-37447
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
233-FB
Species: Hu
Applications: BA
NBP2-19501
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-94469
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
H00064579-D01P
Species: Hu, Rt
Applications: WB
NBP3-03736
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
AF6174
Species: Hu
Applications: IHC, IP, WB
NB100-56148
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-22203
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
MAB6335
Species: Hu
Applications: WB
MAB1230
Species: Hu, Mu, Rt
Applications: ICC, IHC, KO, Simple Western, WB
NBP2-81767
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-58297
Species: Hu
Applications: IHC, IHC-P, WB
AF6240
Species: Hu
Applications: ELISA, IHC, WB

Publications for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01)(1)

Reviews for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01) (0)

There are no reviews for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional N-Deacetylase/N-Sulfotransferase 1/NDST1 Products

Diseases for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01)

Discover more about diseases related to N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01).
 

Pathways for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01)

View related products by pathway.

PTMs for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01)

Learn more about PTMs related to N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01).
 

Research Areas for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01)

Find related products by research area.

Blogs on N-Deacetylase/N-Sulfotransferase 1/NDST1

There are no specific blogs for N-Deacetylase/N-Sulfotransferase 1/NDST1, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10) and receive a gift card or discount.

Bioinformatics

Gene Symbol NDST1
Entrez
OMIM
Uniprot