New pricing — Effective July 1, 2022 -

Amidst rising costs across all areas of our business, and aggressive attempts to implement cost savings without sacrificing quality, we announce the need to implement a cost increase starting July 1, 2022. If you have questions, please contact your sales representative.

Home » N-Deacetylase/N-Sulfotransferase 1/NDST1 » NDST1 Antibodies » N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10)

N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10)

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Western Blot: N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10) [H00003340-M01] - NDST1 monoclonal antibody (M01), clone 1G10 Analysis of NDST1 expression in A-549.
Western Blot: N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10) [H00003340-M01] - NDST1 monoclonal antibody (M01), clone 1G10 Analysis of NDST1 expression in A-549.
Immunohistochemistry-Paraffin: N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10) [H00003340-M01] - Analysis of monoclonal antibody to NDST1 on formalin-fixed paraffin-embedded human small Intestine. Antibody ...read more
Western Blot: N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10) [H00003340-M01] - Western Blot analysis of NDST1 expression in A-549 ( Cat # L025V1 ).
Sandwich ELISA: N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10) [H00003340-M01] - Detection limit for recombinant GST tagged NDST1 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC, IHC-P, S-ELISA
Clone
1G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10) Summary

Immunogen
NDST1 (NP_001534, 38 a.a. ~ 136 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. LYGWKRGLEPSADAPEPDCGDPPPVAPSRLLPLKPVQAATPSRTDPLVLVFVESLYSQLGQEVVAILESSRFKYRTEIAPGKGDMPTLTDKGRGRFALI
Specificity
NDST1 - N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
NDST1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • ELISA
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for IHC-P and ELISA.
Publications
Read Publication using H00003340-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10)

  • [Heparan sulfate]-glucosamine N-sulfotransferase 1
  • bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 1
  • EC 2.8.2.8
  • Glucosaminyl N-deacetylase/N-sulfotransferase 1
  • heparan sulfate-N-deacetylase/N-sulfotransferase
  • HSNST 1
  • HSNST1
  • HSST1
  • HSSTN-HSST 1
  • N-deacetylase/N-sulfotransferase (heparan glucosaminyl) 1
  • NDST1
  • NDST-1
  • N-heparan sulfate sulfotransferase 1
  • NST1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...


N-Deacetylase/N-Sulfot ...
NBP2-81747
Western Blot: N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody [NBP2-81747] - Analysis of N-Deacetylase/N-Sulfotransferase 2/NDST2 in A-20 cell lysate with N-Deacetylase/N-Sulfotransferase 2/NDST2 antibody at 1 ug/ml in (A) the absence and (B) the presence of blocking peptide.
Immunocytochemistry/Immunofluorescence: N-Deacetylase/N-Sulfotransferase 2/NDST2 Antibody [NBP2-81747] - Immunofluorescence of N-Deacetylase/N-Sulfotransferase 2/NDST2 in Daudi cells with N-Deacetylase/N-Sulfotransferase 2/NDST2 antibody at 20 ug/ml.
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NIK/MAP3K14
Antibody - BSA Free
NBP2-23603
Immunocytochemistry/Immunofluorescence: NIK/MAP3K14 Antibody [NBP2-23603] - MAP3K14 antibody was tested in U2OS cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red).
Immunohistochemistry: NIK/MAP3K14 Antibody [NBP2-23603] - Analysis of MAP3K14 in mouse small intestine.
Western Blot: NIK/MAP3K14 Antibody [NBP2-23603] - Detection of MAP3K14 in U2OS cell lysate.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Somatostatin
Antibody (7G5) - BSA
NBP2-37447
Immunofluorescence: Somatostatin Antibody (7G5) [NBP2-37447] - Paraffin-embedded human adult pancreas tissue. pH 9 antigen retrieval. Image from verified customer review.
Immunohistochemistry-Paraffin: Somatostatin Antibody (7G5) [NBP2-37447] - Analysis of lung cancer tissues using SST mouse mAb with DAB staining.
ELISA: Somatostatin Antibody (7G5) [NBP2-37447] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);
(1 Review)
(2 Publications)
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IF, IHC, IHC-P, WB
FGF
basic/FGF2/bFGF [Unco
233-FB/CF
Recombinant Human FGF basic/FGF2/bFGF (146 aa) (Catalog # 233-FB/CF) stimulates cell proliferation of the NR6R‑3T3 mouse fibroblast cell line. The activity is approximately 3-fold greater than the top competitor's FGF basic (146 aa).
1 µg/lane of Recombinant Human FGF basic/FGF2/bFGF (146 aa) was resolved by SDS-PAGE with silver staining, under reducing (R) conditions, showing a band at 17 kDa.
(434 Publications)
Species: Hu
Applications: BA
NDST3 Antibody
NBP2-19501
Western Blot: NDST3 Antibody [NBP2-19501] - Sample (30 ug of whole cell lysate) A: U87-MG 5% SDS PAGE gel, diluted at 1:1000.
Immunohistochemistry-Paraffin: NDST3 Antibody [NBP2-19501] - Immunohistochemical analysis of paraffin-embedded Hepatoma, using antibody at 1:500 dilution.
Species: Hu
Applications: IHC, IHC-P, WB
SND1 Antibody
NBP2-94469
Western Blot: SND1 Antibody [NBP2-94469] - Analysis of extracts of various cell lines, using SND1 at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 1s.
Knockout Validated: SND1 Antibody [NBP2-94469] - Analysis of extracts from normal (control) and SND1 Rabbit pAb knockout (KO) HeLa cells, using SND1 Rabbit pAb antibody at 1:3000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.
Immunohistochemistry-Paraffin: SND1 Antibody [NBP2-94469] - Mouse kidney using SND1 Rabbit pAb at dilution of 1:100 (40x lens).
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, KO, WB
NDST4 Antibody
H00064579-D01P
Western Blot: NDST4 Antibody [H00064579-D01P] - Analysis of NDST4 expression in transfected 293T cell line by NDST4 polyclonal antibody.Lane 1: NDST4 transfected lysate(100.70 KDa).Lane 2: Non-transfected lysate.
Western Blot: NDST4 Antibody [H00064579-D01P] - Analysis of NDST4 expression in PC-12.
Species: Hu, Rt
Applications: WB
Exostosin 1
Antibody
NBP1-91875
Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human rectum shows strong membranous and cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.
Immunohistochemistry-Paraffin: Exostosin 1 Antibody [NBP1-91875] - Staining of human placenta shows moderate ctyoplasmic positivity in trophoblastic cells.
(1 Publication)
Species: Hu, Mu
Applications: IHC, IHC-P
Cytosolic
Sulfotransferase 2B1/ ...
AF6174
Cytosolic Sulfotransferase 2B1/SULT2B1 was detected in immersion fixed paraffin-embedded sections of human prostate cancer tissue using Human Cytosolic Sulfotransferase 2B1/SULT2B1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6174) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hematoxylin (blue). Specific staining was localized to the cytoplasm of glandular epithelial and stromal cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of human prostate cancer tissue. PVDF Membrane was probed with 1 µg/mL of Human Cytosolic Sulfotransferase 2B1/SULT2B1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6174) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Cytosolic Sulfotransferase 2B1/SULT2B1 at approximately 48 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
(1 Publication)
Species: Hu
Applications: IHC, IP, WB
NLRP1/NALP1
Antibody
NB100-56148
Immunohistochemistry: NLRP1/NALP1 Antibody [NB100-56148] - OHT-induced upregulation of Aim2 inflammasome in the retina. NLRP1 antibody labeling (red) in the inner retina; yellow arrows indicate colocalization with RGC neurons (RBPSM+) in the GCL. Image collected and cropped by Citeab from the following publication (Inflammasome Activation Induces Pyroptosis in the Retina Exposed to Ocular Hypertension Injury. Front Mol Neurosci (2019) licensed under a CC-BY licence.
Immunohistochemistry: NLRP1/NALP1 Antibody [NB100-56148] - The NLRP1and NLRP3 proteins localized to distinct cell types in the GCL of naive and NT control retinas: NLRP3 (green) is only expressed in blood vessels (white arrowheads). Twenty four hours after OHT, NLRP3 colocalizes with NLRP1 in RGCs (yellow arrows) and to RBPMS- cells (white arrows). Blue arrowheads denote labeling in RGC axons and dendrites. Bar, 25 um on all panels. Image collected and cropped by Citeab from the following publication (Inflammasome Activation Induces Pyroptosis in the Retina Exposed to Ocular Hypertension Injury. Front Mol Neurosci (2019) licensed under a CC-BY licence.
Immunohistochemistry-Paraffin: NLRP1/NALP1 Antibody [NB100-56148] - FFPE normal human tissue sections stained for NALP1 (CARD7/NAC) using NB100-56148 at 1:2000. (A) epidermis, (B) esophagus (C) uterine cervix, and (D) thymus. Hematoxylin-eosin counterstain. In A-C, NALP1 expression is associated with differentiation in stratified epithelial of the skin, esophagus, and cervix.
(1 Publication)
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
ERK1 Antibody (1E5)
NBP2-22203
Flow Cytometry: ERK1 Antibody (1E5) [NBP2-22203] - Flow cytometric analysis of Hela cells using ERK1 mouse mAb (blue) and negative control (red).
Immunocytochemistry/Immunofluorescence: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of NIH/3T3 cells using ERK1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye. Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: ERK1 Antibody (1E5) [NBP2-22203] - Analysis of paraffin-embedded bladder cancer tissues using ERK1 mouse mAb with DAB staining.
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Heparan Sulfate
2-O-Sulfotransferase ...
NBP1-91982
Western Blot: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane 5: Human liver tissue
Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982] - Staining of human cerebral cortex shows granular cytoplasmic positivity in neuronal cells.
Immunohistochemistry-Paraffin: Heparan Sulfate 2-O-Sulfotransferase 1/HS2ST1 Antibody [NBP1-91982] - Staining of human cerebral cortex shows moderate granular cytoplasmic positivity in neurons.
Species: Hu
Applications: IHC, IHC-P, WB
ERK2 Antibody
(SZ25-01)
NBP2-67360
Flow Cytometry: ERK2 Antibody (SZ25-01) [NBP2-67360] - Analysis of Hela cells with ERK2 antibody at 1/50 dilution (red) compared with an unlabelled control (cells without incubation with primary antibody; black). Alexa Fluor 488-conjugated goat anti rabbit IgG was used as the secondary antibody.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunocytochemistry/Immunofluorescence: ERK2 Antibody (SZ25-01) [NBP2-67360] - Staining ERK2 in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
(1 Review)
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
RAPGEF3 Antibody
(JM63-29)
NBP2-75641
Immunohistochemistry-Paraffin: RAPGEF3 Antibody (JM63-29) [NBP2-75641] - Analysis of paraffin-embedded human prostate tissue using anti-Epac1 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: RAPGEF3 Antibody (JM63-29) [NBP2-75641] - Analysis of paraffin-embedded human stomach cancer tissue using anti-Epac1 antibody. Counter stained with hematoxylin.
Immunohistochemistry-Paraffin: RAPGEF3 Antibody (JM63-29) [NBP2-75641] - Analysis of paraffin-embedded mouse kidney tissue using anti-Epac1 antibody. Counter stained with hematoxylin.
Species: Hu, Mu
Applications: ICC/IF, IHC-P, IP, WB
EphB2 Antibody
[Unconjugated]
AF467
Simple Western lane view shows lysates of COLO 205 human colorectal adenocarcinoma cell line and MBA‑MB‑468 human breast cancer cell line, loaded at 0.2 mg/mL. A specific band was detected for EphB2 at approximately 139 and 146 kDa (as indicated) using 20 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Western blot shows 25 ng of Recombinant Human EphB2 Fc Chimera (Catalog # 5189-B2) and Recombinant Mouse EphB2 Fc Chimera (Catalog # 467-B2). PVDF Membrane was probed with 0.1 µg/mL of Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). A specific band was detected for EphB2 at approximately 120 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 3.
EphB2 was detected in immersion fixed MBA‑MB‑468 human breast cancer cell line using Goat Anti-Human/Mouse EphB2 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF467) at 5 µg/mL for 3 hours at room temperature. Cells were stained using the NorthernLights™ 557-conjugated Anti-Goat IgG Secondary Antibody (red; Catalog # NL001) and counterstained with DAPI (blue). Specific staining was localized to cytoplasm. View our protocol for Fluorescent ICC Staining of Cells on Coverslips.
(9 Reviews)
(37 Publications)
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Heparan Sulfate
6-O-Sulfotransferase ...
AF5057
Western blot shows lysates of H4 human neuroglioma cell line. PVDF Membrane was probed with 1 µg/mL of Human HS6ST1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF5057) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for HS6ST1 at approximately 55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Species: Hu
Applications: WB
Ext2 Antibody
NBP1-58297
Western Blot: Ext2 Antibody [NBP1-58297] - Human Hela, Antibody Dilution: 1.0 ug/ml EXT2 is supported by BioGPS gene expression data to be expressed in HeLa.
Immunohistochemistry: Ext2 Antibody [NBP1-58297] - Formalin Fixed Paraffin Embedded Tissue: Human heart Tissue Observed Staining: Cytoplasmic Primary Antibody Concentration: N/A Other Working Concentrations: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec
Western Blot: Ext2 Antibody [NBP1-58297] - 721_B cell lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: IHC, IHC-P, WB
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF Membrane was probed with 1 µg/mL of Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Prostatic Acid Phosphatase/ACPP protein was serially diluted 2-fold and captured by Mouse Anti-Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB62401) coated on a Clear Polystyrene Microplate (Catalog # DY990). Sheep Anti-Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
(1 Publication)
Species: Hu
Applications: ELISA, IHC, WB

Publications for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01)(1)


Reviews for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01) (0)

There are no reviews for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional N-Deacetylase/N-Sulfotransferase 1/NDST1 Products

Bioinformatics Tool for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01)

Discover related pathways, diseases and genes to N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01)

Discover more about diseases related to N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01).
 

Pathways for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01)

View related products by pathway.

PTMs for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01)

Learn more about PTMs related to N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01).
 

Research Areas for N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (H00003340-M01)

Find related products by research area.

Blogs on N-Deacetylase/N-Sulfotransferase 1/NDST1

There are no specific blogs for N-Deacetylase/N-Sulfotransferase 1/NDST1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our N-Deacetylase/N-Sulfotransferase 1/NDST1 Antibody (1G10) and receive a gift card or discount.


Bioinformatics

Gene Symbol NDST1
Entrez
OMIM
Uniprot