Home » Hemoglobin zeta » Hemoglobin zeta Antibodies » Hemoglobin zeta Antibody (3C4-1D5)

Hemoglobin zeta Antibody (3C4-1D5)

 Submit a Review

Images

 
(
Enlarge)
Western Blot: Hemoglobin zeta Antibody (3C4-1D5) [H00003050-M01] - Analysis of HBZ expression in transfected 293T cell line by HBZ monoclonal antibody (M01), clone 3C4-1D5.Lane 1: HBZ transfected lysate(15.6 KDa).Lane 2: Non-transfected lysate.
Western Blot: Hemoglobin zeta Antibody (3C4-1D5) [H00003050-M01] - Analysis of HBZ expression in transfected 293T cell line by HBZ monoclonal antibody (M01), clone 3C4-1D5.Lane 1: HBZ transfected lysate(15.6 KDa).Lane ...read more
Western Blot: Hemoglobin zeta Antibody (3C4-1D5) [H00003050-M01] - HBZ monoclonal antibody (M01), clone 3C4-1D5 Analysis of HBZ expression in K-562.
Sandwich ELISA: Hemoglobin zeta Antibody (3C4-1D5) [H00003050-M01] - Detection limit for recombinant GST tagged HBZ is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
3C4-1D5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

Hemoglobin zeta Antibody (3C4-1D5) Summary

Immunogen
HBZ (AAH27892, 1 a.a. ~ 142 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGALSKLSELHAYILRVDPVNFKLLSHCLLVTLAARFPADFTAEAHAAWDKFLSVVSSVLTEKYR
Specificity
HBZ - hemoglobin, zeta
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HBZ
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 1:500
  • ELISA
  • Sandwich ELISA
Application Notes
Antibody reactivity against cell lysate and recombinant protein for WB. It has also been used for ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Hemoglobin zeta Antibody (3C4-1D5)

  • HBAZ
  • HBZ
  • HBZ2
  • hemoglobin subunit zeta
  • Hemoglobin zeta chain
  • Hemoglobin zeta
  • hemoglobin, zeta
  • zeta-globin

Background

Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Hemoglobin A2
Antibody
NBP3-05569
Hemoglobin A2 Antibody
Species: Mu, Rt
Applications: WB, IHC
Hemoglobin alpha
Antibody
NB110-41083
Hemoglobin alpha Antibody
(10 Publications)
Species: Hu
Applications: WB, ChIP, ELISA, ICC/IF
Contactin-2/TAG1
Antibody [Unconjugate ...
AF4439
Contactin‑2/TAG1 was detected in immersion fixed frozen sections of mouse embryo (E13) using Goat Anti-Human/Mouse/Rat Contactin‑2/TAG1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4439) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to muscle cells in proximity to ribs. View our protocol for Chromogenic IHC Staining of Frozen Tissue Sections.
Simple Western lane view shows lysates of mouse spinal cord tissue, loaded at 0.2 mg/mL. A specific band was detected for Contactin‑2/TAG1 at approximately 162 kDa (as indicated) using 10 µg/mL of Goat Anti-Human/Mouse/Rat Contactin‑2/TAG1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4439) followed by 1:50 dilution of HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF109). This experiment was conducted under reducing conditions and using the12-230 kDa separation system.
Western blot shows lysates of human cerebellum tissue, mouse brain tissue, and rat brain tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse/Rat Contactin‑2/TAG1 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF4439) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). A specific band was detected for Contactin‑2/TAG1 at approximately 135 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Reviews)
(8 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
Hemoglobin beta
Antibody (7B12)
H00003043-M02
Immunohistochemistry-Paraffin: Hemoglobin beta Antibody (7B12) [H00003043-M02] - Analysis of monoclonal antibody to HBB on formalin-fixed paraffin-embedded human lung. Antibody concentration 3 ug/ml.
ELISA: Hemoglobin beta Antibody (7B12) [H00003043-M02] - Detection limit for recombinant GST tagged HBB is approximately 0.1ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P, S-ELISA
c-jun Antibody
(5B1)
NBP2-37576
Western Blot: c-jun Antibody (5B1) [NBP2-37576] - Analysis using c-Jun mouse mAb against NIH/3T3 (1) and Cos7 (2) cell lysate.
Immunocytochemistry/Immunofluorescence: c-jun Antibody (5B1) [NBP2-37576] - Analysis of PC-2 cells using c-Jun mouse mAb (green). Red: Actin filaments have been labeled with Alexa Fluor-555 phalloidin.
Immunohistochemistry-Paraffin: c-jun Antibody (5B1) [NBP2-37576] - Analysis of human rectum cancer tissues using c-Jun mouse mAb with DAB staining.
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
ASAH1 Antibody
NBP1-89296
Western Blot: ASAH1 Antibody [NBP1-89296] - Analysis in human cell lines SK-MEL-30 and U-251MG using anti-ASAH1 antibody. Corresponding ASAH1 RNA-seq data are presented for the same cell lines. Loading control: anti-HDAC1.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human prostate shows strong granular cytoplasmic positivity in glandular cells.
Immunohistochemistry-Paraffin: ASAH1 Antibody [NBP1-89296] - Staining of human small intestine shows strong granular cytoplasmic positivity in glandular cells.
(6 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
Thyroglobulin
Antibody (2H11 + 6E1)
NBP2-34294
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Thyroglobulin staining in thyroid tissue of normal C57 mouse (Red). Dilution is 1:100. This image was submitted via customer Review.
Immunohistochemistry-Paraffin: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Analysis using Azide/BSA FREE version of NBP2-34294. Human Thyroid stained with Thyroglobulin Ab (2H11 + 6E1).
Immunohistochemistry: Thyroglobulin Antibody (2H11 + 6E1) [NBP2-34294] - Imaging of Mouse stomach tissue. Positive staining can only be observed inside the thyroid cells and the follicle in thyroid tissue. This image was submitted via customer Review.
(2 Reviews)
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IHC-P
c-Fos Antibody
(2H2)
NBP2-50037
Knockout Validated: c-Fos Antibody (2H2) [NBP2-50037] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and c-Fox knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Mouse Anti-Human c-Fox Monoclonal Antibody (Catalog # NBP2-50037) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog #HAF018). Specific band was detected for c-Fox at approximately 52 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Western Blot: c-Fos Antibody (2H2) [NBP2-50037] - Analysis of cell lysates using mouse c-Fos mAb, dilution 1:1,000 (Green), and rabbit GAPDH pAb, dilution 1:20,000 (Red) used as a loading control. [1] protein standard (red), [2] HeLa cells in serum free media. [3] HeLa cells stimulated with 20% fetal bovine serum for 2hrs after 36hrs in serum free media. [4] rat cortical neurons. [5] rat cortical neurons treated with membrane depolarization buffer for 5hrs. Multiple bands at 50-65kDa in stimulated or treated cell lysates correspond to different forms of the c-Fos proten. The single band at 37 kDa represents GAPDH protein.
Immunocytochemistry/Immunofluorescence: c-Fos Antibody (2H2) [NBP2-50037] - Section of rat hippocampus stained with mouse monoclonal antibody to c-FOS NBP2-50037 in red and counterstained with rabbit polyclonal antibody to FOX3/NeuN. DAPI reveals nuclei of neurons and glia in blue. The hippocampal neurons stain green for FOX3/NeuN and a few also are expressing c-FOS, and so appear orange. These cells were spontaneously active at the time the animal was sacrificed.
(1 Review)
(2 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, KO
GATA-1 Antibody
(4F5)
NBP1-47492
Western Blot: GATA-1 Antibody (4F5) [NBP1-47492] - Analysis using GATA1 mouse mAb against K562 (1) cell lysate.
Immunocytochemistry/Immunofluorescence: GATA-1 Antibody (4F5) [NBP1-47492] - Analysis of K562(left) cells using GATA1 mouse mAb (green). Blue: DRAQ5 fluorescent DNA dye.
Immunohistochemistry: GATA-1 Antibody (4F5) [NBP1-47492] - Staining of Fetal Baboon Liver. Antigen retrieval: 10mM sodium citrate, pH 6.0, Primary Ab: 1:500 dilution, Secondary Ab (biotinylated): 1:200, Streptavidin-AlexaFluor488: 1:500 (green), Quench autofluorescence with 1% Sudan Black in 70% methanol. Image from verified customer review.
(1 Review)
(2 Publications)
Species: Hu, Pm
Applications: WB, ChIP, ELISA, ICC/IF, IHC, IHC-P
Hemoglobin epsilon
Antibody
NBP2-43557
Western Blot: Hemoglobin epsilon Antibody [NBP2-43557] - Rat tissue extract (50 ug) was separated by 15% SDS-PAGE, and the membrane was blotted with Hemoglobin epsilon antibody [N1N2], N-term diluted at 1:1000.
Western Blot: Hemoglobin epsilon Antibody [NBP2-43557] - Human tissue extract (30 ug) was separated by 15% SDS-PAGE, and the membrane was blotted with Hemoglobin epsilon antibody [N1N2], N-term diluted at 1:500.
Western Blot: Hemoglobin epsilon Antibody [NBP2-43557] - Untreated (-) and treated (+) mouse tissue extracts (30 ug) were separated by 15% SDS-PAGE, and the membrane was blotted with Hemoglobin epsilon antibody [N1N2], N-term. (CFA = Complete Freund's adjuvant)
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NPRL3 Antibody
(4E6)
H00008131-M02
Western Blot: NPRL3 Antibody (4E6) [H00008131-M02] - C16orf35 monoclonal antibody (M02), clone 4E6. Analysis of C16orf35 expression in IMR-32.
Western Blot: NPRL3 Antibody (4E6) [H00008131-M02] - C16orf35 monoclonal antibody (M02), clone 4E6. Analysis of C16orf35 expression in rat brain.
Species: Hu, Rt
Applications: WB, ELISA
CD4 Antibody
NBP1-19371
Western Blot: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in the following cell lysates: 1) human spleen 2) human tonsil 3) human placenta 4) human kidney 5) human liver 6) mouse spleen 7) mouse placenta 8) rat placenta.
Immunocytochemistry/Immunofluorescence: CD4 Antibody [NBP1-19371] - CD4 antibody was tested in Jurkat cells with DyLight 488 (green). Nuclei were counterstained with DAPI (blue).
Immunohistochemistry-Paraffin: CD4 Antibody [NBP1-19371] - Alcohol-fixed paraffin-embedded rat spleen tissue. Dilution 1:150. Image from verified customer review.
(8 Reviews)
(29 Publications)
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Thrombospondin-1
[HRP]
DTSP10
(1 Review)
(31 Publications)
Species: Hu
JunD [p Ser255]
Antibody (JJ08-21)
NBP2-67861
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in MCF-7 cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Immunohistochemistry-Paraffin: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Analysis of paraffin-embedded mouse liver tissue using anti-Phospho-JunD(S255) antibody. Counter stained with hematoxylin.
Immunocytochemistry/Immunofluorescence: JunD [p Ser255] Antibody (JJ08-21) [NBP2-67861] - Staining Phospho-JunD(S255) in Hela cells (green). The nuclear counter stain is DAPI (blue). Cells were fixed in paraformaldehyde, permeabilised with 0.25% Triton X100/PBS.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
KAT3B/p300
Antibody (RW105)
NB100-616
Immunocytochemistry/Immunofluorescence: KAT3B/p300 Antibody (RW105) [NB100-616] - HeLa cells were fixed in 4% paraformaldehyde for 10 min and permeabilized in 0.05% Triton X-100 in PBS for 5 minutes. The cells were incubated with anti-KAT3B Antibody (RW105)) at 5ug/ml for 60 minutes at room temperature and detected with an anti-mouse Dylight 488 (Green) at a 1:1000 dilution for 60 minutes. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 100X objective.
Western Blot: KAT3B/p300 Antibody (RW105) [NB100-616] - p300 detected in a HeLa nuclear extract using NB 100-616 (1:250). ECL: 20 minute exposure.
Flow Cytometry: KAT3B/p300 Antibody (RW105) [NB100-616] - An intracellular stain was performed on RAW 246.7 cells with KAT3B/p300 antibody (RW105) NB100-616PE (blue) and a matched isotype control NBP2-27287PE (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2 ug/mL for 30 minutes at room temperature. Both antibodies were conjugated to Phycoerythrin. Image using the PE format of this antibody.
(9 Publications)
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, Flow, ICC/IF, IP, In vitro, Flow-IC
CREB [p Ser133]
Antibody
NB300-273
Western Blot: CREB [p Ser133] Antibody [NB300-273] - Western blot of forskolin stimulated rat hippocampal lysate showing specific immunolabeling of the ~45k CREB phosphorylated at Ser133 (Left lane). Phosphospecificity is shown in the right lane where the signal is completely eliminated by treatment with lambda phosphatase(lambda-Ptase, 1200 units for 30 min).
Immunohistochemistry-Frozen: CREB [p Ser133] Antibody [NB300-273] - IHC Analysis of pCREB S133 (red) in frozen sections from mouse piriform cortex. Cell nuclei are visualized with DAPI DNA stain (blue). NB300-273 was used at a dilution of 1:1000 and incubated for 48 hours at 4C. No antigen retrieval step was performed.
(8 Publications)
Species: Mu, Rt
Applications: WB, IHC, IHC-Fr
Human, Mouse, Rat
RelA/NFkB p65 ELISA K ...
NBP2-29661
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Standard curve using the internal RelA standard.
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Nuclear translocation of NF-kB p65 with LPS in Jurkat cells. Jurkat cells, grown to a density of 2X10(6) cells/ml, were treated with LPS (15 ug/ml). The cells were harvested at various indicated time points, and cell lysates were tested in Western analysis using NB100-56712 and also in this ELISA Kit.
ELISA: Human, Mouse, Rat RelA/NFkB p65 ELISA Kit (Colorimetric) [NBP2-29661] - Immunofluorescence indicates NF-kB p65 subunit was expressed exclusively in AA-G groups and AST-G cytoplasm. High glucose stimulation impact on TSMCs in NF-kB pathway. (A) NF-kB p65 protein subunit expression in TSMCs in each group. (B) NF-kB p65 subunit immunofluorescence. Each number denotes different subunits. Alexa 488 green served as secondary antibodies.Citation: Hara K, Hamada C, Wakabayashi K, Kanda R, Kaneko K, Horikoshi S, et al. (2017) Scavenging of reactive oxygen species by astaxanthin inhibits epithelial-mesenchymal transition in high glucose-stimulated mesothelial cells. PLoS ONE 12(9): e0184332. https://doi.org/10.1371/journal.pone.0184332
(85 Publications)
Species: Hu, Mu, Rt
COCO/DAND5
Antibody (OTI2H3)
NBP2-01223
Western Blot: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY DAND5 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-DAND5.
Immunohistochemistry-Paraffin: DAND5 Antibody (2H3) [NBP2-01223] Staining of paraffin-embedded Carcinoma of Human bladder tissue using anti-DAND5 mouse monoclonal antibody.
Flow Cytometry: DAND5 Antibody (2H3) [NBP2-01223] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-DAND5 antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
PSG1 [HRP]
DPSG10
(2 Publications)
Species: Hu
Hemoglobin zeta
Antibody (3C4-1D5)
H00003050-M01
Hemoglobin zeta Antibody (3C4-1D5)
Species: Hu
Applications: WB, ELISA, S-ELISA

Publications for Hemoglobin zeta Antibody (H00003050-M01) (0)

There are no publications for Hemoglobin zeta Antibody (H00003050-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hemoglobin zeta Antibody (H00003050-M01) (0)

There are no reviews for Hemoglobin zeta Antibody (H00003050-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hemoglobin zeta Antibody (H00003050-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional Hemoglobin zeta Products

Bioinformatics Tool for Hemoglobin zeta Antibody (H00003050-M01)

Discover related pathways, diseases and genes to Hemoglobin zeta Antibody (H00003050-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hemoglobin zeta Antibody (H00003050-M01)

Discover more about diseases related to Hemoglobin zeta Antibody (H00003050-M01).
 

Pathways for Hemoglobin zeta Antibody (H00003050-M01)

View related products by pathway.

PTMs for Hemoglobin zeta Antibody (H00003050-M01)

Learn more about PTMs related to Hemoglobin zeta Antibody (H00003050-M01).

Blogs on Hemoglobin zeta

There are no specific blogs for Hemoglobin zeta, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hemoglobin zeta Antibody (3C4-1D5) and receive a gift card or discount.


Bioinformatics

Gene Symbol HBZ
Entrez
OMIM
Uniprot