Hemoglobin zeta Antibody (1G10)

Images

 
Western Blot: Hemoglobin zeta Antibody (1G10) [H00003050-M03] - Analysis of HBZ expression in transfected 293T cell line by HBZ monoclonal antibody (M03), clone 1G10. Lane 1: HBZ transfected lysatE (15.6 KDa). Lane 2: ...read more
Immunohistochemistry-Paraffin: Hemoglobin zeta Antibody (1G10) [H00003050-M03] - Analysis of monoclonal antibody to HBZ on formalin-fixed paraffin-embedded human prostate. Antibody concentration 3 ug/ml
Sandwich ELISA: Hemoglobin zeta Antibody (1G10) [H00003050-M03] - Detection limit for recombinant GST tagged HBZ is approximately 10ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC-P
Clone
1G10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Hemoglobin zeta Antibody (1G10) Summary

Immunogen
HBZ (NP_005323, 1 a.a. - 81 a.a.) full length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGAL
Specificity
HBZ (1G10)
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
HBZ
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry-Paraffin
Application Notes
Antibody reactivity against transfected lysate and recombinant protein for WB. It has been used for ELISA and IP.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Hemoglobin zeta Antibody (1G10)

  • HBAZ
  • HBZ
  • HBZ2
  • hemoglobin subunit zeta
  • Hemoglobin zeta chain
  • Hemoglobin zeta
  • hemoglobin, zeta
  • zeta-globin

Background

Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult like. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41083
Species: Hu
Applications: WB, ChIP, ELISA
AF4439
Species: Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-14081
Species: Hu
Applications: IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
MAB17791
Species: Hu, Mu
Applications: WB
NBP2-43557
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-88447
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
MAB5526
Species: Hu, Mu
Applications: WB
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-01223
Species: Hu
Applications: WB, Flow, IHC, IHC-P
MAB6799
Species: Hu
Applications: WB, IHC

Publications for Hemoglobin zeta Antibody (H00003050-M03) (0)

There are no publications for Hemoglobin zeta Antibody (H00003050-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Hemoglobin zeta Antibody (H00003050-M03) (0)

There are no reviews for Hemoglobin zeta Antibody (H00003050-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Hemoglobin zeta Antibody (H00003050-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Hemoglobin zeta Products

Bioinformatics Tool for Hemoglobin zeta Antibody (H00003050-M03)

Discover related pathways, diseases and genes to Hemoglobin zeta Antibody (H00003050-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Hemoglobin zeta Antibody (H00003050-M03)

Discover more about diseases related to Hemoglobin zeta Antibody (H00003050-M03).
 

Pathways for Hemoglobin zeta Antibody (H00003050-M03)

View related products by pathway.

PTMs for Hemoglobin zeta Antibody (H00003050-M03)

Learn more about PTMs related to Hemoglobin zeta Antibody (H00003050-M03).

Blogs on Hemoglobin zeta

There are no specific blogs for Hemoglobin zeta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Hemoglobin zeta Antibody (1G10) and receive a gift card or discount.

Bioinformatics

Gene Symbol HBZ
Entrez
OMIM
Uniprot